KEGG   Paenibacillus polymyxa E681: PPE_00180Help
Entry
PPE_00180         CDS       T01319                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00340  Histidine metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01230  Biosynthesis of amino acids
Module
ppy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ppy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PPE_00180
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     PPE_00180
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     PPE_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADM68065
UniProt: E0RAF2
LinkDB All DBs
Position
204179..204919
Genome map
AA seq 246 aa AA seqDB search
MSNELNQRLSLEQILDNVRWNEAGLVSAIVQDDATLQVLTLAYMNRESLKLSLESGETWF
WSRSRQELWHKGATSGNTQKITSIQLDCDGDALLVRVIPSGPACHTGATSCFFRDISAPG
TAVAPVAENAGDHTLVNQTDDISSASADRFEVLAQLEAIIKEREETRPEGAYTTYLFDKG
VDKILKKVGEEASETIIAAKNKDNDELRLEVSDLIYHLLVLLQERKLPLDDVLTELNRRH
ERPRRD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaattgaaccaacggctatctctggagcagatactggataatgtccgctgg
aatgaggcaggtcttgtctcggcgattgtgcaggatgatgctacgcttcaggtgctgacg
ctggcctatatgaaccgtgagtcgctgaaactatctttggagtcgggagagacctggttc
tggtctcgttccagacaggagctgtggcacaagggggctacttcggggaatacgcaaaaa
atcacctccatccagctggattgtgacggtgatgccctgttggtacgtgttattccgagt
ggtcctgcctgtcatacaggagcaacgagctgcttttttcgtgatatttccgcgccagga
acggctgtagcacctgttgcagaaaatgcaggagaccacacgctggtaaatcaaaccgat
gatatttccagtgcttcagcagaccgctttgaggtacttgcccagctggaggcgattatt
aaggagcgcgaagagacacgtcctgaaggggcctatacgacttatctttttgataaaggt
gtagacaaaatcttaaaaaaggttggcgaagaagcatccgagacgatcattgccgccaaa
aataaagataatgacgaactgcgcctggaggtcagcgatttgatttatcacctgctggtg
ctgttgcaggagcgcaagctaccgctcgatgatgtgctgactgagttgaatcgccgtcat
gaacgtcctcgtcgtgattag

DBGET integrated database retrieval system