KEGG   Paenibacillus polymyxa E681: PPE_01385Help
Entry
PPE_01385         CDS       T01319                                 

Definition
(GenBank) DNA repair ATPase
Organism
ppy  Paenibacillus polymyxa E681
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZapA HIP1_clath_bdg
Motif
Other DBs
NCBI-ProteinID: ADM69225
UniProt: E0RBC4
LinkDB All DBs
Position
1490173..1492197
Genome map
AA seq 674 aa AA seqDB search
MTTPDRTRVTVEIYGTSYKLVGSNTDYMKQVANYVDERMHSISQAHSRLDMPRIAVLAAV
HMAEEAVQIQEIQSHMNRLAAERAELRGDLAQLQTALGEQQQKNTDMHQSLIQLKEEKEA
TQKKLMETESVSAKEIAQLKAKLEQQEKKAAELENGQKQAKRELEESRQEASRKLKEQQE
AANARIRQIEEQMKKEVAEAAKQAEAKLSAAEKTHQEQKRTELDKLRSALQQEHSKKVSE
WQTKCSGLNEQLEQERKQAELALNEEKLQHQEAQKRADEAALEQEIRVEELQEQLEQVQA
GSTELSSRLGEAQEQARVLKQQQSELESVLETQRQVAIEREQADTLAREELQSRYDQLEA
EAKAAQQQTAKLEEEQRRMQKLLEQAHVSSRKLQSELATLAESEKSWRKLAEERQLAVDE
LELSLLEAREQKEAIQEQLQHAVSELEAIKDKFASQQQRLVQLEARIKELSPELIRVQDE
LEKAKVREQEGAKAYQSLQEQYGSMKSRARQLEQNIKQLQQEDHERQSKLERAEEESLEW
QLKYDQLKAEAERLEAEDAARREEFASWEREIAVTVEQKEQLQEETRLAVEAAKMAKAEQ
QSIEQERMALQSELDEVGQKYEMAAHQLRLLQVQQDVDRESTEKISTELRQLQEEYTKLQ
TEYNEWIELIEQDQ
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgactacaccagatcgtactcgcgtcactgtagagatctacggtacttcttataaactc
gtcggcagcaataccgattatatgaagcaggttgctaattacgtggatgagcgtatgcac
agcatttctcaagctcattcgcgtctggatatgccccgaattgccgtgctggctgcggtt
catatggcagaagaagctgtacaaatccaggaaattcagagtcatatgaaccgcttagca
gcggaacgagcagagctccggggagatctggcgcaactccagacggctctaggggaacag
cagcaaaaaaatacagatatgcatcaatctcttattcaactaaaggaagaaaaggaagca
acgcagaagaagctgatggaaaccgaatctgtatcagccaaggagattgcccaattgaag
gcaaagctggaacaacaggagaaaaaagcggctgaacttgaaaatggacaaaaacaagct
aaacgtgaattagaggagtctcgtcaagaagcttcgcgcaagctgaaagagcagcaggag
gcggccaatgctcgtatccggcagatagaagagcagatgaagaaggaagtggctgaagcg
gctaaacaggctgaagccaagctgtcagctgcagagaagactcatcaggagcaaaagcgt
acagaactggacaagctgcgatctgctttgcagcaagagcatagtaagaaggtaagcgaa
tggcagactaagtgctccgggctgaatgagcagctggaacaggaacgtaaacaggctgaa
ttggcgttgaatgaagaaaagctccagcatcaggaagcgcagaaacgagctgatgaagct
gcactggagcaggagattcgggttgaggagcttcaggaacaattagaacaagtacaggca
ggcagtacagagctttcttctcgtctgggagaggctcaagagcaagcaagagtactgaag
caacaacagtccgagctggagtctgtgctggaaacacagcgacaggttgcgatagagcga
gagcaggcagatacgcttgcacgtgaagaactgcaaagccgatatgatcaattagaagct
gaagccaaggctgcgcagcagcagacggctaagctggaggaagaacagcggcggatgcag
aagctgttggagcaagctcacgtatcttctcgcaagctgcaaagtgagctggctacgcta
gctgaaagcgagaagtcatggaggaaacttgcagaagaacgccagttggcagttgatgag
ctggagctctccctgctggaagcgcgtgaacagaaggaagcaatacaggagcaattacag
cacgcagtgtctgagctcgaagctattaaggataaatttgcttcacaacagcaacggcta
gttcaactcgaagcgagaattaaggagctttcacctgagctgattcgcgttcaggatgag
cttgagaaagcaaaagtccgagagcaagagggagctaaggcgtatcaatcgcttcaggag
caatatggaagcatgaagagccgagctagacagctggagcaaaatatcaagcagcttcaa
caggaagatcacgaacggcagagtaaactggaacgtgctgaggaagagtctttggagtgg
caacttaaatacgatcagttgaaggcagaagcggaacgtctggaagctgaagatgctgcc
cgtagggaagaatttgcatcttgggaacgggaaatagcggtaacagttgaacaaaaggaa
cagcttcaggaagagactcgtttggcggttgaagctgccaaaatggcgaaagctgaacag
cagtccatagagcaggaacgaatggccttgcagtctgaattggacgaagtaggtcaaaaa
tatgaaatggcggcgcatcagcttcgtttgttacaagtacaacaggacgtagatcgggaa
agtacggagaagatttctacagaattacgtcaattacaggaagaatacacgaagcttcaa
acggagtacaatgaatggattgaacttatcgaacaggatcagtag

DBGET integrated database retrieval system