KEGG   Paenibacillus polymyxa E681: PPE_02529Help
Entry
PPE_02529         CDS       T01319                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00020  Citrate cycle (TCA cycle)
ppy00260  Glycine, serine and threonine metabolism
ppy00280  Valine, leucine and isoleucine degradation
ppy00310  Lysine degradation
ppy00380  Tryptophan metabolism
ppy00620  Pyruvate metabolism
ppy00630  Glyoxylate and dicarboxylate metabolism
ppy00640  Propanoate metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
Module
ppy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_02529
   00020 Citrate cycle (TCA cycle)
    PPE_02529
   00620 Pyruvate metabolism
    PPE_02529
   00630 Glyoxylate and dicarboxylate metabolism
    PPE_02529
   00640 Propanoate metabolism
    PPE_02529
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_02529
   00280 Valine, leucine and isoleucine degradation
    PPE_02529
   00310 Lysine degradation
    PPE_02529
   00380 Tryptophan metabolism
    PPE_02529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppy04147]
    PPE_02529
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     PPE_02529
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PPE_02529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA FAD_oxidored FAD_binding_3 Pyr_redox_3 HI0933_like FAD_binding_2 UDPG_MGDP_dh_N NAD_binding_8 DAO AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADM70359
UniProt: E0R9Y4
LinkDB All DBs
Position
complement(2789067..2790488)
Genome map
AA seq 473 aa AA seqDB search
MVVGDASLDIDTLVIGAGPGGYVAAIRAAQLGQSVLIVDKSELGGVCLNRGCIPSKALIS
AAHQYEAAKHGESFGITAENVKVDFAKTQEFKNGVVKKMTGGVSGLLKGNKVEVFNGECM
FINENEARVFNEHESPRYRFKNAIIATGSRPIELKPFPFGGRILSSTEALNLPEIPKSLI
VIGGGYIGAELGQMYSKFGSKVTIIEGMDTVLPGFDKDMTSIVAKSMKKTGIEIFTGAKA
ESAEQTDKDVTVKFSVNGESKEVTADYLLVTVGRRPNTDGELGLDLIGVELDDRGMVKVD
HQGRTSIPHIFAIGDIVAGLALAHKASYEGKVAAEAIAGEPSVVDYKCMPAVVFTDPECS
SVGYTETQAKEKGYNVKVGKFSYGANGRAVSLNAAEGFVKIVADADTGLVLGTQIVGLEA
SNLIAELGLAIEMGATLEDISLTIHAHPTLGEIVMEAAEVVLGHPIHALAPRR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaggagacgcttctctggatattgacacattggttatcggtgcgggtcctggc
ggctatgtagctgccatccgtgccgcacaattgggacaaagcgtattgatcgttgacaaa
tctgagctgggcggtgtctgtctgaaccgtggatgtattccatccaaagctttgatctct
gcagctcatcaatacgaagcagctaaacatggcgagtctttcggtattactgctgagaac
gtaaaagtagactttgctaaaacacaagaattcaaaaacggtgttgttaagaaaatgaca
ggcggcgtaagtggcttgctcaaaggcaacaaagttgaagttttcaatggtgagtgcatg
ttcatcaacgaaaacgaagcgcgtgtattcaacgaacatgaatcaccacgttaccgtttt
aaaaatgcaattatcgcaacaggttcccgtccaatcgaactgaaaccattcccatttggc
ggacgcattctatcttctacagaagcattgaacctgcctgaaattccgaaaagcctgatc
gtaatcggtggtggatacattggtgcagagcttggacaaatgtactccaaattcggttcc
aaagtaacgattattgaaggtatggatacagtacttcctggtttcgacaaagatatgact
tcaatcgttgcgaaaagcatgaagaaaactggcatcgaaatctttactggcgctaaagcg
gaaagtgcagagcaaacagataaagacgtaacagtgaaattctccgttaacggcgaaagc
aaagaagtaactgctgattatctgcttgtaactgttggacgtcgtccaaacactgacggt
gagctgggtctggatcttatcggtgtagaactggatgaccgtggaatggtgaaagttgat
caccaaggacgtactagcattcctcacatctttgcaatcggcgatatcgtagctggtctt
gctctggcacacaaagcttcttacgaaggtaaagtggctgctgaagcaatcgcaggcgag
ccgtctgtagtagattacaaatgtatgccagctgtcgttttcacagatccagaatgctct
agcgtaggctacacagaaacacaagctaaagaaaaaggctacaatgtcaaagttggcaag
ttctcttatggagcaaacggtcgtgcggtttccctgaacgctgctgaaggttttgtgaaa
atcgtagctgacgctgacactggtctggtactgggtacgcaaatcgtaggtctggaagct
tccaaccttattgctgagctgggtctggcgattgaaatgggtgctacactcgaagatatc
tccttgactattcatgctcaccctacattgggcgaaatcgttatggaagcagcggaagtc
gtgctgggtcacccgattcatgcattggcaccacgtcgctaa

DBGET integrated database retrieval system