KEGG   Paenibacillus polymyxa E681: PPE_04407Help
Entry
PPE_04407         CDS       T01319                                 

Definition
(GenBank) flagellar cap protein FliD
  KO
K02407  flagellar hook-associated protein 2
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ppy00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    PPE_04407
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ppy02035]
    PPE_04407
Bacterial motility proteins [BR:ppy02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    PPE_04407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N MGS Ribosomal_S8
Motif
Other DBs
NCBI-ProteinID: ADM72167
UniProt: E0RHN6
LinkDB All DBs
Position
complement(4825111..4826583)
Genome map
AA seq 490 aa AA seqDB search
MVTRISGLASGMDIDAMVKKLMTAERVPLDKLNQQKQLMEWKRENYRESSTKIVSFLQDK
LTTLSRTASMNPQKVTVSGNSDALTASASSSASGVLDISVTNLATAARSVSDSSWSEKAS
SELAFADGAARTVQVGGATIDVDANETIESFVKKINDNSKAGVTALYDAKSGLSLTSKTT
GSQTFNIDSQISSEFKLSSTNGTDAVLKVNGLDVTKSSNNFTINGVDITLKTAGGAATRI
EATKDTDKIVENIQSFVDAYNDVLSTLNGKVGEERYKKYTPLTTEQKAAMSDDEVKLWET
KAKSGMLRNDPILQDALSEMRNAMIQGVDIGRVDADGKNKPLMMSELGITTGTYDTKGKL
ILDADKLRAAVEKDPDIIANFFGKQDPSTALTNKYTQQDGVIAKLKKISNTSLQRMADTA
GTSKVSKDLTASFLSTSTMGEQLTSLDRRISDMTSRLTMIETNYYKKFTAMETAISKYNN
ASSSLTGMSS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagaataagtgggcttgcctcaggcatggatattgatgcaatggttaaaaag
ctgatgacagctgagcgtgtaccgcttgataagctgaatcaacaaaaacaactaatggaa
tggaaacgagaaaactatcgtgagtccagtactaaaattgtttcatttctacaagataaa
ctgacgacattaagccgtactgcttcaatgaatccgcaaaaagtaacagtatcgggaaat
agtgacgcgttgactgcatcggcttcatcgtctgccagtggagtgttggatatctcggta
accaatcttgctactgccgcaagatctgtctcagacagctcatggtctgaaaaggctagt
agtgaactggcatttgccgatggggcagcccgtacggttcaggttggtggtgctaccatt
gatgtggatgcaaacgaaacgattgaatcgtttgtcaaaaaaattaatgataacagtaag
gctggagtaactgctctgtatgatgccaaatctggtttgtcattaacaagtaaaaccacc
ggttcgcaaacattcaatattgattctcaaattagtagtgaatttaaactatcttcaacg
aacggaaccgatgctgtattaaaggtaaatgggttagacgtaacgaagtcttccaataac
tttacaataaatggtgttgacattacacttaagacagccggtggtgctgcgacaagaata
gaagctaccaaagataccgataagattgtggagaatattcaaagctttgttgatgcctat
aatgatgttctctctacactcaatggcaaggttggtgaggagaggtataagaaatatact
ccgcttacgacggaacaaaaagccgctatgagcgatgatgaagtcaaactctgggaaacc
aaggctaagagtggcatgcttagaaacgatcctatcctgcaggatgcattatctgaaatg
cgtaatgccatgattcaaggtgtagatatcggccgagttgatgcagatggcaagaataag
cctttaatgatgtctgagcttgggatcactacgggaacgtatgatacgaaaggtaagcta
attttggatgcagacaaattgcgtgcagcggttgaaaaagacccggatattatcgcgaat
ttttttgggaaacaggatccaagtaccgcgctaactaataaatacacacagcaagatggt
gttattgctaaacttaaaaagatttcgaatacttcactgcaaagaatggccgatacagcc
ggtacttcaaaagttagtaaggatctaactgcttcatttctttctacgagcacaatggga
gagcaattaacgagtctggaccgtcgaattagtgacatgaccagccgtctaacgatgatt
gaaactaactattacaaaaaattcaccgccatggaaacggcaataagcaagtataataat
gcttcttctagtcttacaggcatgtcgtcataa

DBGET integrated database retrieval system