KEGG   Paenibacillus polymyxa E681: PPE_04416Help
Entry
PPE_04416         CDS       T01319                                 

Definition
(GenBank) flagellar protein
Organism
ppy  Paenibacillus polymyxa E681
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DZR RPA_C NMD3 HTH_19 HTH_Mga HTH_3 PolC_DP2
Motif
Other DBs
NCBI-ProteinID: ADM72176
UniProt: E0RHP5
LinkDB All DBs
Position
complement(4832616..4833026)
Genome map
AA seq 136 aa AA seqDB search
MNLDNCPRCGKLFIKNVRGICQNCIKEIEFEYERCVKHIRENKGIHMHELSEATEVSVKQ
ITTFIREGRISIANAPNMTYPCEVCGIPIREGHMCDSCRTRLTKDLNQAVRDSSNQDQSN
NMGSGTYSAIDKLRGK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggataactgtcctcgctgtggaaagctgtttattaagaatgtcaggggaatc
tgtcagaactgtattaaagaaattgaatttgaatacgaacgctgtgtcaaacatatacgt
gaaaataagggcattcatatgcatgagctttcagaggctactgaggtatccgtaaaacaa
atcacgacatttatacgtgagggacgtatttccattgctaatgcgcccaatatgacgtat
ccttgcgaggtatgcgggataccgattcgtgaagggcatatgtgcgattcttgtcgaaca
cgtctgactaaagacctgaatcaggctgtacgcgacagtagtaatcaggatcaaagtaat
aatatgggctcaggtacctacagcgcgattgataaacttcgtggaaagtag

DBGET integrated database retrieval system