KEGG   Paenibacillus polymyxa E681: PPE_04663Help
Entry
PPE_04663         CDS       T01319                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00500  Starch and sucrose metabolism
ppy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPE_04663
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PPE_04663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ADM72422
UniProt: E0RKY5
LinkDB All DBs
Position
5096205..5097698
Genome map
AA seq 497 aa AA seqDB search
MKRNHTMMQFFEWNVEADGSHWKKLARLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTREDLLEAVAACVRHGVAVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIEGWTKFTFPGRQGKYSTFQWNFEHFNGTDYDASQDRTGIYRILGK
NKSWSENVDDEFGNYDYLMFANIDYNHQDVRKEMIRWGKWLVDTLQCNGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLESCQKFLDTIDYKIDLFDVSLHYKLHSASLG
GKDFDLSTIFEDTLVHTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGQTPVKGKQAELDPLLYARYHKAYGEQKDYFDDPHTIGWVRQGVPELE
GSGCAVVITNANDGEKRMFVGKQHAAGEWIDLTGHHDHTVKIEQDGYGIFPVRAGSVSVW
ALPAEEDSQETEEEANA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcaatttttcgagtggaatgtcgaagctgacggttct
cactggaaaaagcttgcccgcctggcaccggaactgaaggccaaaggaattgacgcgata
tggattccacctgtcaccaaaggccagtcgcccgaggatacgggatacggcgtctatgac
ctttacgatctgggcgaatttgaccaaaaaggcgcggtgcgcaccaaatacggaaccagg
gaagacctgctggaagctgttgccgcctgcgttcgtcacggtgtggcggtctatgtcgat
ctggtcatgaaccataaagctggcgcggatgaaaccgaagtattcaaggtcgtcgaggtc
aacccggataaccgcaatgaggtcatttccgagccctttgatatcgaaggctggactaaa
tttacattccccggccgacaagggaagtattccacatttcaatggaactttgaacatttt
aacggaaccgattacgatgcgagccaggaccggacaggaatctatcgtattttaggtaaa
aataaaagctggagcgaaaatgtagatgatgaattcggcaattatgattatttaatgttc
gccaatattgactataatcatcaggatgtgcgcaaagagatgatccgctggggcaaatgg
ctggtggatactctgcaatgcaacggattccgtctggatgcaatcaagcatattaatcat
gaatttgtacgagagtttgctacagaaatgattaaaaaacgcgggcaggatttttatatg
gtaggtgagttttggaaaccggatctggagtcatgtcaaaagttcctggataccattgat
tataaaatcgacctatttgacgtatccctccactacaaactacatagcgcttccttgggt
ggcaaggatttcgatttaagcaccattttcgaggatacgcttgttcatacccatcccctg
aactcggttacttttgtcgataatcatgattcccagccgcacgaagcgctcgaatcctgg
gtggaggactggtttaagcccagcgcctatgcacttatcttgctgcgcaaggacggttat
ccctgcgtattctatggcgattactacggtatccagggacaaacgcccgtgaaaggcaag
caagctgagctagacccgcttctatatgcccggtaccataaagcttatggtgagcaaaaa
gattatttcgatgatccccacacgattggatgggttcgtcaaggcgtgcctgagctggaa
ggctccggatgtgctgtggtgatcaccaacgcaaatgacggagaaaagcgcatgttcgta
ggcaaacaacatgcagcgggagaatggatagatttgaccggacatcacgatcataccgta
aagattgagcaggatggctacggcatatttcccgttcgtgccggcagtgtatcggtgtgg
gcacttcccgcagaggaagacagccaggaaacagaagaagaagcgaacgcttaa

DBGET integrated database retrieval system