KEGG   Pseudomonas poae: H045_00135Help
Entry
H045_00135        CDS       T02456                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppz  Pseudomonas poae
Pathway
ppz00473  D-Alanine metabolism
ppz00550  Peptidoglycan biosynthesis
ppz01100  Metabolic pathways
ppz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    H045_00135 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H045_00135 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    H045_00135 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppz01011]
    H045_00135 (ddl)
Enzymes [BR:ppz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     H045_00135 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ppz01011]
 Precursor biosynthesis
  Amino acid ligase
   H045_00135 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: AGE24103
LinkDB All DBs
Position
31842..32936
Genome map
AA seq 364 aa AA seqDB search
MSKLRVGIIFGGRSAEHEVSLQSARNIVDALDRSRFEPILMGIDKAGHWHLNDTSDFLIN
QENPALIALNQSNRELAVVPGKASQQVVETSGQALLEHIDVIFPIVHGSLGEDGCLQGLL
RMADLPFVGSDVLGSAVCMDKDISKRLLRDAGIAVTPFITLTRRTVARTSFDMAVNTLGL
PMFVKPANQGSSVGVSKVADEAEYHAAVELALGFDEKVLVESAVSGREIECAVLGNERPI
ASGCGEIVVSSGFYSYDSKYIDDQAAQVVVPADISMQACERIRSLAVEAFEVLGCAGLAR
VDVFLTDDGEVLINEINSLPGFTRISMYPKLWQAAGMSYSELVSRLIDLALERHAGRKGL
KTSR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttgcgtgtaggtattatttttggtggccggtcggctgagcatgaggtgtcg
ttgcaatcggcgcgcaacattgtcgatgcattggaccgttcgcgcttcgagccgattctg
atgggtatcgacaaggccgggcactggcacttgaacgacacctcggactttctgatcaat
caggaaaacccggccctgatcgccctcaaccaatccaatcgtgagctggcggtagtgccg
ggcaaggccagccagcaagtggtggaaacctccggccaggctctgctggaacatatcgat
gtgattttccccatcgttcacggttcccttggcgaggacggctgcctgcaaggcttgctg
cgcatggcggacctgcccttcgttggctccgacgtgctcggttcggcggtgtgcatggac
aaggacatcagcaagcgtctgctgcgcgacgcaggcattgccgtcactccgttcatcact
ctcacccgacgtaccgtcgcgcgtacatcctttgacatggcggtgaacacactgggcctg
ccgatgttcgtcaaacccgccaaccagggctcatcggtgggcgtcagcaaagtcgccgac
gaagccgagtaccacgccgctgtagaactggcgctcgggtttgatgaaaaagtgctggtg
gagtccgccgtcagcggccgtgaaatcgaatgcgcggtgctgggtaacgagcgcccgatt
gccagcggttgcggcgagatcgtggtgagcagcggcttctactcctacgacagcaaatac
atcgacgaccaggccgcccaggtggtggtgccagcggatatcagcatgcaggcctgcgag
cgtattcgcagcctggccgttgaggcgttcgaggtgctgggttgcgccggtctggcgcgg
gttgatgtgtttctcacggacgacggcgaagtgctgatcaacgaaatcaactcgttgccc
ggcttcacccgcatcagcatgtaccccaagctgtggcaggctgcggggatgagctacagc
gaactggtgagccggctgatcgaccttgcgctggagcggcatgcggggcgcaaggggttg
aagaccagtcgctga

DBGET integrated database retrieval system