KEGG   Pseudomonas poae: H045_01470Help
Entry
H045_01470        CDS       T02456                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ppz  Pseudomonas poae
Pathway
ppz00471  D-Glutamine and D-glutamate metabolism
ppz00550  Peptidoglycan biosynthesis
ppz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    H045_01470 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H045_01470 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppz01011]
    H045_01470 (murC)
Enzymes [BR:ppz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     H045_01470 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:ppz01011]
 Precursor biosynthesis
  Amino acid ligase
   H045_01470 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGE24370
LinkDB All DBs
Position
313348..314793
Genome map
AA seq 481 aa AA seqDB search
MVENQKAMPQPEMRRIRRIHFVGIGGVGMCGIAEVLLNLGYQVSGSDLKESPVTDRLKTF
GAQIFIGHRAENAAEADVLVVSSAVNTSNPEVATALERRIPVVPRAEMLAELMRYRHGIA
VAGTHGKTTTTSLIASVFAAGGLDPTFVIGGRLNAAGTNAQLGTSRYLIAEADESDASFL
HLQPMVAVVTNIDEDHMATYDGDFNKLKKTFVEFLHNLPFYGLAVLCLDDPVVREILPQV
KRPTVTYGFSEDADVRAINVRQEGMQTYFTVLRPDREPLDVSVNMPGNHNVLNSLATICI
ASDEGVSDEAIVEGLSRFAGVGRRFQVYGQLPVDGGDVMLVDDYGHHPTEVAAVIKAVRG
GWPERRLVMVYQPHRYSRTRDLYDDFVNVLADANVLLLMEVYPAGEEPIPGADSRKLCNS
IRQRGQLDPIYIERGVDLAPIVKPLLRAGDILLCQGAGDIGGLAPKLLASPLFAAQKGVS
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaatcagaaagccatgccacaacccgaaatgcgccgcatccgtcgcatccac
ttcgtcggcatcggcggcgtgggcatgtgcggtattgccgaagtgctgctgaacctgggc
tatcaggtgtccggctcggacttgaaagagtcgccggtgaccgaccgcctgaagaccttc
ggcgcacagatctttatcggccaccgtgccgagaacgccgccgaggctgacgtgctggtg
gtgtccagcgccgtgaacacctccaacccggaagtggccaccgcccttgagcgtcgcatt
ccggtggtgccgcgcgccgaaatgctcgccgagctgatgcgctaccgtcacggcatcgcc
gtggccggcacccatggcaaaaccaccactaccagcctgatcgcctcggtgttcgccgcc
ggtggcctggacccgaccttcgtcatcggtggccgcctgaatgcagccggcaccaatgcc
cagctcggcaccagtcgctacctgatcgccgaagccgatgaaagcgatgcgagcttcctg
cacctgcaaccgatggtcgccgtggtcaccaacatcgacgaagaccacatggccacctac
gacggtgacttcaacaagttgaagaagaccttcgtcgagttcctgcacaacctgccgttc
tacgggttggcggtgctgtgcctggacgatccggtggttcgtgaaatcctgccgcaggtc
aagcgcccgaccgtgacctacggcttcagcgaagacgccgacgtgcgggcgatcaacgtg
cgccaggaaggcatgcagacctacttcaccgtgctgcgtcccgaccgcgagccgctggat
gtctcggtcaacatgccgggcaaccacaacgtgctcaattccctggcaaccatctgcatc
gcctccgatgaaggcgtcagcgatgaagccatcgtcgaaggcctgtcacgctttgccggc
gtggggcgtcgcttccaggtctacggccaactgccggtggacggcggcgacgtgatgctg
gtggacgactacggtcaccaccccaccgaagtggccgccgtgatcaaggccgtgcgcggt
ggttggccggagcgtcgcctggtgatggtctaccagccgcatcgctacagccgcacccgc
gatctgtacgacgatttcgtcaatgtcttggccgatgccaacgtgctgttgttgatggaa
gtctatccagccggtgaagagccgattccgggtgccgacagccgcaagctgtgcaacagc
atccgccagcgtgggcagttggacccgatctacatcgagcgtggcgtggacctggcaccg
atcgtcaagccgctgctgcgtgccggcgacatcctgctgtgccagggcgccggtgacatc
ggtggccttgcacccaagttgctcgccagtccgctgtttgccgcgcagaagggggtgtcg
aaatga

DBGET integrated database retrieval system