KEGG   Pseudomonas poae: H045_05955Help
Entry
H045_05955        CDS       T02456                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
ppz  Pseudomonas poae
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppz03400]
    H045_05955
Enzymes [BR:ppz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     H045_05955
DNA repair and recombination proteins [BR:ppz03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    H045_05955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2
Motif
Other DBs
NCBI-ProteinID: AGE25265
LinkDB All DBs
Position
1289722..1292079
Genome map
AA seq 785 aa AA seqDB search
MDLQQGFVLTRHWRDTPEGTQVSFWLATDQGPRFIRLPVQTSVMFIPEAHRKPLDWLLKD
EREIELRPLQLCDFHHRPVLGLYTRQHRQAMDLEKRLRTAGVDVYEGDVRPPERYMMERF
ITAPVWFGGTPDADGTLLDAQMKPAPDYRPPLKLVSLDIETTAQGDLYCIGLQGCGERQV
YMLGPPNNTCAVDFKLDYCDTRAQLIEALNLWLATHDPDAIIGWNVVQFDLRVLHEHAQR
LNVPLMLGRGDEPMAWREHGSRNHYFAAAAGRLIIDGIEALRSATWSFESFSLENVAQTL
LGEGKDISTPYQRMDEINRMFAEDKPALARYNLKDCELVTRIFAKTELLKFLLERASVTG
LPADRNGGSVAAFTHLYLPLMHRQGFVAPNLGDKPPQASPGGFVMDSRPGLYESVLVLDY
KSLYPSIIRSFLIDPVGLVEGLKHPDDSDSVEGFRGARFSRTRHCLPAIVARVSEGREVA
KRERNAPLSQALKIIMNAFYGVLGSSGCRFFDTRLASSITLRGHEIMRQTRALVEAQGYE
VIYGDTDSTFVWLGSAQSQEDASRIGQALVAHVNEWWRAHLQTAFGLHSALELQFETHFT
RFLMPTIRGAEEGSKKRYAGLVVRTDGSEEMVYKGLETVRSDWSPLARRFQQELYQRVFH
RQPHQDYIRDYVRRTLSGEFDELLIYRKRLRRRLDDYERNVPPHVRAARLADDYNDRLGR
PRQYQRGGWISYVISVNGPEPLEVRQAPIDYDHYVTRQLQPVADAILPFVNDDFSTLVGG
QMGLF
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
gtggatttacagcagggttttgtcctgacccggcattggcgcgacaccccggaaggcacg
caggtcagcttctggctggccaccgaccaggggcccaggttcatccgcttgcccgtgcag
acctcagtgatgttcatccccgaagcccatcgcaagccgctcgattggctgctcaaggac
gagcgcgagatcgagctgcggccgttgcagttgtgcgattttcatcaccgccccgtcctt
ggcctgtatacacgccagcaccgccaggcgatggacctggaaaagcgcctgcgcaccgcc
ggcgtcgacgtctacgaaggcgacgtgcgcccgcccgagcgctacatgatggagcgcttc
atcaccgcgccggtgtggttcggtggcacacccgatgccgacggcaccttgctcgacgcg
cagatgaaacccgcccccgactaccgcccgccgctcaagctggtgtccctggacattgaa
accactgcccagggcgatctctattgcattggcctgcaaggctgcggcgagcgccaggtg
tacatgctcggcccgccgaacaacacctgcgcggtggacttcaagcttgattactgcgac
acccgcgcccaactgatcgaagccctcaacctctggctcgccacccatgaccccgatgcg
atcatcggctggaatgtggtgcagttcgacctgcgcgtgctccacgaacatgcccagcgc
ctcaacgtgccgctgatgcttggccgtggcgatgaaccgatggcttggcgcgaacatggc
agccgcaatcattactttgccgccgccgcagggcgcctgatcatcgacggcatcgaagcc
ctgcgctcggcgacctggagtttcgagtccttcagcctggaaaacgtcgcgcaaaccctg
ctcggcgaaggcaaggacatctccacgccgtaccagcgcatggacgaaatcaaccgtatg
ttcgccgaggacaagcccgccctggcgcgctacaacctcaaggactgcgaattggtcacg
cggattttcgccaaaaccgagctgctcaagttcctgctggagcgggccagcgtcaccggg
ttaccggccgaccgcaacggtggttcggtcgccgcctttacacacctgtacctgccgctg
atgcaccgtcagggcttcgtcgcgccgaacctgggcgacaaaccaccccaggccagcccc
ggcggctttgtcatggattcacgccctggcctgtatgaatcggtgctggtgctggactac
aaaagcctctacccgtcgatcatccgcagtttcctgatcgacccggtgggcctggtcgaa
ggcctcaagcaccctgacgacagcgactcggtggaaggctttcgcggtgcgcgtttttcc
cgcacccggcactgcctgcccgccatcgtcgcgcgggtttccgaaggccgcgaagtggcc
aagcgtgagcgcaacgcgccgctgtcccaggcgctgaaaatcatcatgaacgccttctac
ggcgtccttggctccagcggttgccggttcttcgacacgcggctggcctcgtcgatcacc
ttgcgtggccatgaaatcatgcgccagacccgcgcgctggtcgaagcccagggctatgaa
gtgatctacggcgacaccgactccaccttcgtctggctcggcagcgcccagtcccaggag
gacgccagccgcatcggccaggcgctggtggcgcacgtcaacgagtggtggcgtgcgcac
ctgcagacggcgttcggcctgcacagtgcgctggagttgcaattcgagacccacttcaca
cgctttctgatgccgaccatccgcggcgcggaggagggcagcaagaaacgctacgccggg
ctggtggtgcgcaccgacggcagcgaagagatggtctacaaaggccttgaaaccgtgcgc
agcgactggtcgcccctggcccgacggttccagcaggaactctaccagcgcgtcttccac
cgccagccccaccaggattacattcgcgactacgtgcgacgcaccttgagcggcgagttc
gatgaactcctgatctaccgcaaacgcctgcgtcgacgcctggacgactacgagcgcaac
gtgccgccccatgtgcgcgccgcgcgcctggccgatgactacaacgaccgcctcggccgc
ccgcgccagtaccagcgtggcggctggatcagctacgtcatcagcgtcaacggcccggag
ccgctggaagtgcggcaggcgccgatcgactatgaccactacgtgacgcgacaattgcag
ccggtggcggacgcgatcctgccgttcgtgaatgacgacttcagcaccctcgttggcggg
caaatggggctgttttaa

DBGET integrated database retrieval system