KEGG   Pseudomonas poae: H045_07420Help
Entry
H045_07420        CDS       T02456                                 

Definition
(GenBank) putative trehalose synthase protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppz  Pseudomonas poae
Pathway
ppz00500  Starch and sucrose metabolism
ppz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H045_07420
Enzymes [BR:ppz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     H045_07420
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     H045_07420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C MMPL
Motif
Other DBs
NCBI-ProteinID: AGE25554
LinkDB All DBs
Position
1633283..1636645
Genome map
AA seq 1120 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSAAREFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLGVMRFWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGNTKSGDKKGDDGDECHMAFHFPLMPRMYMALAQ
EDRFPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLG
IRRRLAPLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSI
DRNGGFSRADPASLVLPPIMDPQYGYQSVNVETQAQDPHSLLNWTRRMLAVRKQSKAFGR
GSLKMLSPSNRRILAYTREFTGEDGHTEIILCVANVSRSAQAAELDLSAFAGMVPVEMLG
GNAFPPIGQLNFLLTLAPYGFYWFVLAAENQMPSWHVEPAQSIPDFTTLVLKKRMEELLE
APCRNTLEHDSLPLWLPKRRWFAGKDATIDSVHIAYGVRFGDPEHPVLLSEIEVSSGGQV
SRYQLPFGFLREDQFTSALPQQLALARVRRTREVGLVTDAFSLEHFVRAVIQALQAGTVL
DCSDGALRFAATAHLDALQLASDVSVRYLSAEQSNSSVVVGERLVLKLIRKVSAGVHPEL
EMSAYLTEAGYPNISPLMGSMIRRDGEGQDNLLMIAQGYLSNQGDAWSWTQNNLERAIRD
ELAEAISEQEQHYNALGELADFAGMLGQRLGEMHGVLGAPTGNNNFKPEATSARDTQAWA
KDVGAQIERALQLLKLNQHQLNPADQTLVSELLAQKKAIGSQVQALAKATLGGLRIRVHG
DLHLGQVLVVKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMALNVQGV
DHSPEADLARKRVTDHYLNEARQAFIQAYEAAASTLAHDWQDAKGQDAALTLFSLEKAAY
EVAYEAENRPTWLAVPLQGLHALLSGLAPISKTARGGETS
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaaggcagccacgttcatcaaggatccgctctggtacaaggacgcg
gtgatctaccaggttcacgtcaaatcctatttcgactccaacaatgatggtatcggcgac
tttcccgggctgatcgccaagctcgattacattgccgacctgggcgtcaacaccatctgg
ctgttgccgttctacccctcaccacgccgtgatgacggttatgacattgccgaataccgt
ggcgtgcacagcgactacgggaccatggccgatgcccggcgcttcattgccgaggcccac
aagcgtgggttgcgggtcatcaccgagctggtgatcaaccacacctccgaccagcatccc
tggttccagcgtgcgcgcaaggccaagcccggttcggccgcccgggagttctatgtctgg
tccgatgacgaccagaagtacgacggcactcgcatcattttcctcgacaccgaaaagtcc
aactggacctgggacccggtggccgggcagtacttctggcaccgcttctattcgcaccag
ccggatctcaacttcgataacccgcaagtgatgaaggccgtcctgggcgtgatgcgtttc
tggctggacatgggcatcgacggcctgcgcctggacgccattccgtacctgatcgagcgc
gacggcaccaacaacgaaaacctgcctgagacccacgatgtgctcaagcaaatccgcgcc
gagatcgacgcgcattaccccgaccgcatgctgctggccgaagccaatcaatggccagag
gacacgcagctgtattttggcaacacaaagagcggtgacaaaaagggcgacgacggcgac
gaatgccacatggcctttcacttcccgctgatgccgcgcatgtacatggcgctggcccag
gaagaccgctttccgatcaccgacatcctgcgccagaccccggagatcccggccaattgc
cagtgggcgatcttcctgcgcaaccacgatgagctgaccctggagatggtcaccgacaag
gagcgcgactacctgtggaactactacgccgccgaccgccgcgcgcgcatcaacctgggc
attcgtcggcgtctggcgccgttgatggagcgcgaccgccgtcgcgtcgagttgctcaat
agcctgctgctgtcgatgcccggcacgccgaccctgtattacggcgatgaaatcggcatg
ggcgacaacatttacctgggcgaccgcgacggtgtgcgcacgcccatgcagtggtccatc
gaccgcaacggcggcttctcccgcgccgacccggcgagtctggtgctgccgccgatcatg
gacccgcaatacggctaccagtcggtcaacgtggagacccaggcccaggacccgcactca
ctgcttaactggacccggcgcatgctcgcggtgcgcaagcagtccaaggcgtttggtcgc
ggcagcctgaaaatgctctcgccaagcaaccggcgcattctcgcttacacccgcgagttc
accggggaggacgggcacactgaaatcatattgtgtgtggccaacgtgtcgcgcagcgcg
caggcggcggagctggacttgtcggctttcgccggcatggtcccggtggagatgctcggc
ggcaacgcgttcccgccgattggtcagctcaatttcctgctgaccctggcgccgtacggc
ttctactggtttgtgctggccgctgaaaaccagatgcccagctggcatgtcgagccagcg
cagagcattcccgacttcaccactttggtactgaaaaaacgcatggaagaattgctcgaa
gcaccttgccgcaacaccctcgaacacgactccctgccgctctggctgcccaagcgccgc
tggtttgccggtaaggacgccaccatcgacagcgtgcacatcgcctacggcgtgcgcttt
ggcgacccggagcacccggtgttgctcagcgaaatcgaagtgagcagcggcgggcaggtg
agccgttaccaattgcccttcggttttctgcgtgaagaccagttcaccagcgccttgccc
cagcaattggccctggcccgcgtgcggcgcacgcgcgaagtgggcctggtgactgatgca
ttcagccttgagcattttgttcgcgcagtgatccaggccctgcaagccggcacagtgctc
gattgcagcgacggtgccctgcgctttgccgcaaccgcgcacctggacgcgttgcaactg
gcgagtgacgtgtcggtgcgttacctctccgccgagcagtccaacagctcggtggtggtg
ggtgagcgcctggtgctcaagctgatccgcaaagtcagcgccggggtgcaccccgagctt
gaaatgagcgcttacctcaccgaggccggctacccgaatatctcgccgctgatgggttcg
atgattcgccgtgatggcgagggtcaggacaacctgttgatgatcgcccagggttacctg
agcaaccagggcgacgcgtggagctggacccagaacaatctggagcgtgcgatccgtgac
gaactggccgaggccatttccgagcaagagcagcattacaacgccctgggcgaactggcg
gacttcgccggcatgctcggccagcgcctgggcgagatgcacggcgtgctcggcgcgccc
actggcaacaacaacttcaagccagaagccacctcggccagggacacccaggcctgggcc
aaagacgtgggcgcgcagatcgagcgcgccctgcaattgctcaagctcaatcaacatcag
ttgaaccccgccgatcagacgctggtcagtgaactactggcgcagaaaaaagccatcggc
agccaggtccaggcgttggcgaaagccacgctgggcgggttgcgcattcgcgtgcacggt
gacttgcacctgggccaggtgctggtcgtgaagggggatgcctacctgatcgactttgaa
ggcgagccggcaaggccgctgcatgagcggcgcggcaagcacagcccttacaaggatgtg
agcggtgtgctgcgttcgtttgactacgcggcggccatggcgcttaacgtacagggggtg
gatcactcgcccgaagcggaccttgcgcgcaagcgtgtgaccgaccactacctgaacgaa
gcacgccaggcatttatccaggcctatgaggctgcggcgtctacactggcgcatgactgg
caggatgccaagggccaggacgccgcgctgacactgttcagcctggagaaagctgcgtat
gaagtggcttacgaagcggaaaatcgcccgacctggttggcggtgccattacaaggcttg
cacgcattgttgagcgggcttgccccaatatcgaaaactgcacgcggtggggagacgtca
tga

DBGET integrated database retrieval system