KEGG   Pseudomonas poae: H045_12890Help
Entry
H045_12890        CDS       T02456                                 

Definition
(GenBank) peptide synthase
Organism
ppz  Pseudomonas poae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C TAL_effector AMP-binding_C_2 SAVED Thump_like
Motif
Other DBs
NCBI-ProteinID: AGE26643
LinkDB All DBs
Position
complement(2978370..2991260)
Genome map
AA seq 4296 aa AA seqDB search
MMDAFELPRTLVQSLQRRAAQTPDQVALRFLAESAEHNVVLSYRDLDLRARTIAAALQAS
AAQGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTKRHHQERLLSIITDAEPRLL
LTIASLAEGLAQIENAPPILSVDTVQGVGEWIAPQLQPDDIAFLQYTSGSTALPKGVQVS
HGNLVANEVLIRRGFGIDLNPHDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAYFL
GRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSQWRVAYSGSEPIRLDTL
ERFAEKFAVCGFSDNNFIASYGLAEATLFVAGGRRGQGIPALRVDDQALAANRAEPGQGS
AIMSCGTGQPDHAVLIVDPHTLSELADNHVGELWASGPSIAHGYWRNPEATAKTFMQHAG
RTWLRTGDLAFMRDGEVYITGRLKDLLIVRGHNLYPQDIEQTIERDVEVVRKGRVAAFAV
NDEGLEGIGIAAEISRSVQKILPPEALIKAIRQAVAEAYQQAPSVVVLLNPGALPKTSSG
KVQRSACALRHADGSLDSYAQFPGLPVQTQDAVLESELQNQIAAIWCEHLHVNQVAADDH
FFLLGGNSITATQVVARLRESLGLELNLRLLFEAPTLQDFAASVARLQQDGGVAQGAIQA
LSRQAELPQSLAHNRLWITWQLQPDSSAYTIPGALRLRGELDEDAVRASFQYLVQRHEAL
RTRFYERDGQAFQRIEASGAFELRVIDLSDQPAHERDACAQQIREDEAQTRFDLEKGPLL
QVTLVRLDDEEHQLLVTLHHIIADGWSLNILIDEFSRLYAAASQGQPLELAPLALQYADY
GSWQRQWLAEGEGPRQLAYWKARLGDEHPALSLATDHPRSARHRHTAARHSVRLSADLCE
AVRKAAQAHESTPFMLLLAAFQTLLHRYTGQRDIRIGVPNANRPRQETQGLVGFFINTLV
LRAELDGRLPFNQLLAATRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQRDL
SALRRLPGLLADELPWHSREAKFDLQLHSEEDRHGRLSLAFDYADELFDGATIQRLAEHY
IALLHAACAQPQQAIGDLPLMPQDEQRQWNTTPCAPATQWLPELLNQHTSQATALVWEHG
SLSFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLVGLLAIIKAGGAYVPLDPDY
PAERLAYMLKDSGVHLLLTQTSLLAQLPSAEGVCVIAMDSLHLDSWPTQPPGLHLHGDNL
AYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYQLDANDVLMQKAPISFDVSVWECFWP
LITGCRLVLAGPGEHRDPHRIAQLVQAHGVTTLHFVPPLLQLFIDEPLAAECTSLRRLFS
GGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWQCAVVDGERSPIGRPLGNVICR
VLDAQLNPLPAGVPGELCIGGIGLARGYLGRAGLTAERFVADPLGEPGTRLYRTGDRARW
SIDGVLEYLGRLDQQVKLRGFRVEPEEIEARLLAQDGVAQAVVLVRDAQLIGYYTGHAEL
APQALKAALAAELPEYMVPAVLMRLDAMPLSPSGKLDRRALPEPVWHIREHVEPQSPLQQ
QIAAIWREVLGLPRIGLHDDFFALGGHSLLATQIISRTRQACDVELSLRTLFDASELGAF
AAQVALIQNAGQRNQQTAIARVDRNQKVPLSYSQQRMWFLWQMEPDSPAYNVGGMARLRG
VLDVGRFEAALQALIMRHETLRTTFPSVDGVAYQRVAAQTGLRMDWQDFSALNEAERPQR
IQQLADHEAHTPFNLETGPLLRACLVKAAEQDHYLVLTLHHIVTEGWAMDIFARELSALY
EAFIDERDSPLAPLPVQYLDYSVWQRQWMEAGERQRQLDYWTAQLGHEHPLLELPGDRPR
PSVQSHRGELYRFDLSVDLAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIGAP
VANRIRPESEGLIGAFLNTQVLRCRLNGQMSVGELFEQVRHTVIEGQSHQDLPFDHLVEA
LQPPRSAAYNPLFQVMCNVQRWEFQQSRQLAGMSVEYLANDARATKFDLNLEVTDLDHRL
GCCLTYSTDLFDEPRIARMAEHWRNLLEALIADPQQRLSELPLLVAAEQRALQDSLGVEA
GEYRLDQCIHSLFSQQALKRGDAPALTFAGETLTYAELDARANRLAWVLRERGVGPQVRV
GLALPRSLEMVVGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFEALGP
LPATVACWCLENDLPKLANYPVSEVPFVSLAQHQAYLIYTSGSTGKPKGVVVSHGEIAMH
CQAVIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDAEQICALIRT
HRINILGFTPSYGSQLAQWLATQQQTLPVRMCITGGEALTGEHLQRIRAAFQPQVFFNAY
GPTETVVMPLASLAPEQLDEGAASVPIGSLIGARVAYILDADLALVPQGATGELYVGGAG
LALGYHQRPGMTAERFVADPFAREGGRLYRTGDLVRQRADGLVEYLGRIDHQVKIRGFRI
ELGEIETRLLEHPAVREAVVLALEALSGKQLVAYLVSDAEHGALRDALKAHLKAQLPDYM
VPAHLIVLDSMPLTANGKLDRRALPQPDPEANRQQYVAPRTALQSTLAAIWCAVLNVQQV
GLDDNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATRAEQVMAEQGV
LTGASALTPIQHWFFDSDIPAREHWNQSLLLKPLQLLDPHRLEQALLAVLEHHDALRLSF
TRRDAQWHAEHLGVPLGGALMQAQVKDMAQCAALFTETQRSLDLQHGPLLRALLIDGPEG
QQRLLIAIHHLVVDGVSWRVLLEDLQNVYRQLSDGRSVSLPAKTSALREWAARLQAYAHS
ESLREELSLWQRQLAGPRVLLPVARPQGALRNRDAETVSVRLDAERTRHLLQQAPSAYRT
QVNDLLLTALARVVCRWSGHDSAVIQLEGHGREALFDDIDLTRSVGWFTSAYPVRLTPAA
AQGDSIKAIKEQLRGVPHKGLGYGVLRYLADDLCKQTLMALPDAPITFNYLGQFDQSFGS
DALFHPLDEPAGLAHDPDAPLPNELSVDSQVYGGELVLRWTFSRERHTPQTIRALAEGYL
AELQGLIEHCLEDEAVGLTPSDFPLAHLNQAQLDSLPVAASRIEDVYPLTPMQEGLLLHT
LLEPGTGLYYMQDRYRINSVLDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHKPG
SAPIEYLDWSRDPEDEQEPRLQALLKQERETGFDLLNQAPFHLRLIRVGQARYWFMMSNH
HILIDAWCRSLLMNDFFEIYLALGEGRAAQLATPPRYRDYIAWLQRQDLNEARQWWQRNL
QGFERTTPIPSDRPFLREHAGHSGGMLVGDCYTRLDACDGAQLRELAQAHQLTVNTFAQA
AWALVLRRLSGERDVLFGVTVAGRPVDMPEMQRTVGLFINSIALRVKLPEDDQPCSVRQW
LSGLLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVDTSVLDHAQSLNAT
SDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDETTVQGMLGEFKRLLLALMQGFHGDM
ADLPLIGDQERAFLVEGCNQSAQDYPLARSYVELFEEQVAQHPQRIAASCLDQRWTYEQL
NRRSNGLGHALISAGVGLDQPVALLAERNLDLLGMIIGSFKAGAGYLPLDPGLPAQRLSR
IIELSRTPLLVCSEACREQAIELLEGTQCQLLVWEEVPARGENPGIYSAADNLAYVIYTS
GSTGLPKGVMVEQRGMLNNQLSKVPYLELSPADVIAQTASQSFDISVWQFLAAPLFGARV
DIVPNAIAHDPQGLLEHVQAQGITVLESVPSLIQGMLAHDRISLDGLRWMLPTGEAMPPE
LAHQWLQRYPQIGLVNAYGPAECSDDVAFFRVDLASTRGTYLPIGTPTDNNRLYLLDGAL
DLVPQGAVGELCVAGTGVGRGYVGDPLRTAPVFVPNPFGAPGERLYRTGDLARQRSDGVL
EYVGRIDHQVKIRGYRIELGEIQARLHEQPEVRDAAVGVQEGANGKHLVGYLVAADAALD
PDERLDRIKQRLRAELPEYMVPLHWLWLDRLPLNANGKLDRNALPELEIGQLHRQGYLAP
RNELETTLAAIWAEVLKVERVGVRDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMFEC
STVAELAEYIEGLVGNEISVEKVDRLSDLMAELEGL
NT seq 12891 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttccccgcaccctggtccagtcccttcaacgccgtgccgcg
cagaccccggaccaggtcgccctgcgcttccttgccgagtcggccgagcacaacgtggtg
ctcagttaccgcgacctcgacctgcgcgcgcgcaccattgccgcagccctgcaagccagc
gccgcacagggtgaccgtgcggtgttgctgttccccagcgggccggactatgtggcggcg
ttcttcggctgcctgtacgccggggtcattgcggtgccggcttacccgccggagtccacc
aaacgccatcatcaggagcgcctgctgtcgatcatcacagatgccgaaccgcgcctgctg
ctgaccatcgccagcctcgccgagggcctggcacagattgagaacgcgccgccgatactg
agcgtcgataccgtgcagggtgtcggcgagtggatcgcgccccaactgcagcccgacgac
atcgcgttcctgcaatacacctccggctccactgcgctgcccaaaggcgtgcaggtcagc
cacggcaatctggtggctaacgaagtgctgatccgccgtggctttggcattgatctgaac
ccgcatgacgtgatcgtcagctggctgccgctgtaccacgacatgggcctgatcggcggc
ctgctgcaaccgatcttcagcggcgtgccttgcgtgctgatgtcgccagcctacttcctt
ggccggccgttgcgctggctggaagcgatcagcgaatacggcggcaccatcagcggcggt
ccggatttcgcctaccgcctgtgcagcgaacgggtcagcgagtccgcactggaacgcctc
gacctgagccagtggcgcgtggcctattccggttccgaaccgatccgcctcgataccctg
gaacgcttcgccgagaagttcgccgtctgcgggttcagcgacaacaactttatcgcctct
tatggcttggccgaagcgaccctgtttgtcgccggtgggcgccgtggtcagggcatcccg
gcgctgcgggtggatgaccaggcgctggccgccaaccgtgccgagccggggcagggcagt
gcgatcatgagctgcggcaccggtcagcccgaccatgccgtactgatcgtcgacccgcat
accctgagcgaactggcggacaaccacgtcggcgaactctgggccagcggcccaagcatc
gcccacggctactggcgcaaccctgaagccaccgccaaaacgttcatgcagcatgccggc
cgcacctggttgcgcaccggggacctggccttcatgcgcgacggtgaggtgtacatcacc
ggtcgcttgaaggacctgctgatcgtgcgcggccacaacctgtatccccaggacatcgaa
cagaccatcgagcgcgacgtggaagtggtgcgcaaggggcgggtcgccgcgtttgcggta
aacgatgagggcctggaaggcatcggcatcgccgccgaaatcagccgcagcgtgcagaaa
atcctgccgcccgaagcgctgatcaaggctatccgtcaggcggtggccgaggcgtatcaa
caggccccgagcgtggtggtgctgctcaatcctggcgcgctgcccaaaacctccagtggc
aaggtgcagcgctcagcctgcgcgcttcgtcacgccgatggcagcctcgacagctacgcg
cagttccccggtttgcccgtgcagacccaggatgcggtgctggaatccgagctgcaaaac
cagatcgcggcgatctggtgcgagcacttgcacgtcaaccaagtcgctgccgacgatcac
ttcttcctgctcggcggcaactccatcaccgccacccaggtggtcgcacggctgcgcgaa
agcctggggttggagctgaacctgcgcctgctgttcgaagcaccgaccctgcaggatttt
gccgccagcgttgcccgtttgcagcaggacggcggtgtcgcccagggcgcgattcaggcc
ctgtcgcgccaggccgaactgccgcaatccctggcacataaccgcctgtggatcacctgg
cagctgcagcccgacagcagtgcctacaccattcccggcgcgctgcgcctgcgcggcgag
ctggatgaagacgccgtgcgcgcaagcttccagtacctggtccagcgccacgaagcgctg
cgcacgcgcttctatgagcgcgacggccaggccttccagcgcatcgaggcgagcggggcg
ttcgagctgcgcgtcatcgacctcagcgaccagcctgcccatgagcgtgacgcctgcgcg
cagcagatccgcgaggacgaagcgcagacccggttcgatctcgaaaaaggcccactgttg
caagtgaccctggtgcgtctggacgatgaagagcaccagttgctggtgaccctgcatcac
atcatcgccgacggttggtcgctgaatatccttatcgatgaattctcgcgcctgtacgcc
gcggcctcccagggccagcccctggagctggcgccgctggcgctgcagtacgccgattac
ggcagctggcagcgccaatggttggccgaaggcgaaggcccgcggcaactggcgtactgg
aaggcccgccttggcgatgagcatccggccttgagcctggccaccgaccacccgcgctcg
gcccgtcaccgccacaccgccgcccgccacagcgtgcgcctgagcgccgacctctgcgaa
gcggtgcgcaaagcggcccaggcccatgagtcgacgccgttcatgctgttgctcgccgcg
ttccagaccctgctccatcgctacactggccagcgcgatatccgcatcggcgtgcctaac
gccaaccgcccgcgccaggaaacccaggggctggtcggcttcttcatcaacaccctggtg
ttgcgtgccgagctggacgggcgcctgccattcaatcaactgctggcggcaacgcgccag
gccgcactcggcgcccaggcccatcaggacctgcccttcgagcaactgctggaagccttc
ccccaggcccgcgaacagggcctgttccaggtcatgttcaaccaccagcagcgcgacctg
agtgcattgcgccgcctgcccggcctgctcgccgatgagctgccctggcacagtcgcgaa
gccaagttcgacctgcaactgcacagcgaagaagaccgccatggacgcctgagcctggcg
ttcgactacgctgatgagctgttcgatggcgcaaccatccagcgtctcgccgaacactac
attgcgctgctgcacgccgcctgcgcgcagccgcaacaggcgattggcgacttgccgctc
atgcctcaggacgagcagcgccaatggaacaccacgccttgtgcgcccgccacccagtgg
ctgcccgagttgctcaatcagcacacctcgcaggccacggcgctggtgtgggagcacggc
agcctgagcttcgcccaactgcatacccaggccaaccgtctggcccattacctgcgcgac
aaaggcgtcggcccggacgtgtgcgtggccatcgccgccgagcgctcgccgcagctgctg
gtcggcctgctggcgatcatcaaggccggcggcgcctatgtgccgctcgacccggattac
ccggccgagcgcctggcctacatgctcaaggacagcggcgtgcacctgctgctcacccag
acctcactgctggcgcaactgcccagcgctgaaggggtgtgcgtcatcgccatggacagc
ctgcacctggacagctggccaacccagccgcccggcctgcacctgcacggcgataatctc
gcctacgtgatctacacctccggctccaccggccagcccaagggcgtgggcaacacccat
gcggccctggccgaacgcttgcaatggatgcaggccacctatcagctcgacgccaacgac
gtgctgatgcaaaaggcgccgatcagtttcgacgtgtcggtgtgggaatgcttctggcca
ttgatcaccggttgccgtctggtgctggccgggcccggtgagcatcgcgatcctcatcgc
attgcgcagttggtgcaggcgcatggcgtgaccacgctgcacttcgtgccgccattgttg
cagttgtttatcgacgaaccgctggcggccgagtgcaccagcttgcgtcgcctgttctcg
ggcggcgaagccttgcccgccgagttgcgcaaccgtgtgctggcgcagttgccggcggtg
cagttgcacaaccgctatggcccgacggaaaccgcgatcaacgtcacccactggcagtgc
gcggtggtcgatggcgagcgctcgccgattggccggccgttgggcaatgtgatctgccgc
gtgctggatgcgcaactcaacccgctgccggccggtgtgccgggcgagctgtgcatcggc
ggcatcggcctggcccggggttacctgggccgggccgggctgaccgccgaacgttttgtc
gccgacccgctgggcgagcccggcacgcgcctgtaccgcaccggtgaccgtgcgcgctgg
agcattgacggcgtgctcgaataccttggccgcctggatcagcaagtgaagctgcgcggg
ttccgcgtggagccggaagaaatcgaagcgcgcctgctcgcccaggacggcgtcgcccag
gccgtggtgctggtgcgcgatgcgcagttgatcggctactacaccggccatgccgagctg
gccccccaggcgctgaaagccgccctggccgccgagctgccggaatacatggtgcccgcc
gtgctgatgcgcctggacgcaatgccgctgagccccagcggcaaactcgaccgccgcgcg
ttgccggaaccggtgtggcacatccgcgaacacgtcgagccgcaatcaccgctgcagcag
cagatcgccgcgatctggcgcgaagtgctcggcttgccgcgtatcggcctgcacgacgac
tttttcgccctcggtggccactcgttgctggccacgcaaatcatctcgcgcacccgtcag
gcctgcgacgtcgagctgtcgttgcgtaccttgttcgacgccagcgaactgggcgcgttt
gcagcccaagtcgcgctgatccagaacgccggccagcgcaatcagcaaaccgccatcgcc
cgggtcgaccgcaaccagaaggtgccgctgtcctactcccagcaacgcatgtggttcctc
tggcaaatggaacccgacagcccggcctataacgtcggtggcatggcgcgcttgcgcggc
gtgctggacgtgggccggttcgaggcggcgttgcaggccttgatcatgcgccacgaaacc
ctgcgcaccacgttcccgagcgtcgatggcgtggcgtatcagcgggtcgcggcgcaaacc
ggcctgcgcatggactggcaggacttctcggcgctgaacgaggccgagcgcccgcaacgc
atccagcaactggccgaccacgaagcccacacccccttcaacctggaaaccggaccgtta
ctgcgcgcgtgcctggtcaaggccgccgagcaggaccattacctggtgctgaccctgcac
cacatcgtcaccgaaggctgggccatggacatctttgcccgtgaactgagcgccctgtac
gaagcctttatcgacgagcgcgactcgccgctggcgccgctgcctgtgcaatacttggat
tacagcgtgtggcaacgccagtggatggaagccggcgagcgccagcgccagctcgattac
tggaccgcgcaacttgggcatgagcacccgttgctggaactgcccggtgaccgtccacgg
ccatccgtgcaaagccaccgaggcgaactgtatcgctttgatctgagcgttgatctggcg
gcgcgcgtacgcgcgttcaacgccgaacgtggcctcacgctgttcatgaccatgaccgcg
acactggcggtgttgctctaccgctacagcggccagaccgacctgcgcatcggcgcgccg
gtggccaaccgcattcgcccggaaagcgaagggctgatcggcgcgttcctcaatacccag
gtgctgcgctgccggctcaacgggcagatgagcgtcggcgagctgttcgagcaggtgcgc
cacacggtgatcgaggggcagtcgcaccaggatctgccgttcgaccacctggttgaagcc
ttgcaaccgccgcgcagtgcggcgtacaacccacttttccaagtgatgtgcaacgtgcag
cgctgggagttccagcaaagccgccaactggccggcatgagcgtcgagtacctggccaac
gatgcgcgcgccaccaagttcgacctcaacctggaagtcaccgacctcgaccatcgcctg
ggttgctgcctgacctacagcaccgacctgttcgatgaaccacgcattgcacgcatggcc
gagcattggcgcaacctgctggaggcgttgatcgccgatccgcagcagcgcctcagcgag
ttgccgctgcttgtggcggcagagcagcgtgccttgcaggacagcctcggggttgaagcc
ggtgagtatcgcctcgaccagtgcatccattcgctgttcagccagcaggcgctcaagcgc
ggtgacgcccccgcgctgaccttcgccggtgaaaccctgacctacgccgaactcgatgca
cgcgccaatcgcctggcctgggtgctgcgtgaacgcggtgtgggcccgcaggtgcgggtg
ggcctggcgttgccgcgctcactggaaatggtcgtcggcttgctggcgatcctcaaggca
ggcggcgcctacgtaccgctggacccggagtacccgctggaccgcctgcactacatgatc
gaagacagcggcatcggcctgttgctcagcgatgcggcgatgttcgaggccctcggcccg
ttgccggcgaccgtggcctgctggtgcctggaaaatgacctgccgaagctggcgaactac
cccgtcagcgaggtgccatttgtcagcctggcgcaacatcaggcgtacctgatctacacc
tcgggctccaccggtaaacccaagggcgtggtggtgtcccatggtgaaatcgccatgcat
tgccaggcggtgatcgagcgtttcggcatgcgcccggacgactgcgagctgcatttttat
tcgatcaatttcgacgccgccaccgagcgtttgctggtgccgctgctcagcggtgcgcag
gtggtattgcgtgcccaggggcagtgggatgccgagcaaatctgcgcgctgatccgtacc
catcgcatcaatattctcggtttcaccccaagctatggcagccagttggcgcagtggctg
gccacccagcagcagacgttaccggtgcgcatgtgcatcaccggtggcgaagcgctgacc
ggtgaacatctgcagcgcattcgcgcagcgttccagccgcaagtgtttttcaatgcctat
ggcccgaccgaaaccgtggtgatgccgctcgccagcctggccccggagcagctggacgag
ggtgccgccagcgtaccgatcggcagcctcatcggcgcgcgcgtcgcctatattctcgac
gccgacctggcgctggtgccgcagggcgcaaccggcgagctctacgttggcggcgccggt
ctggccctggggtatcaccaacggccgggcatgacggcggagcgttttgtcgcggacccg
tttgcccgcgagggcggtcgtctgtaccgcaccggcgacctggtgcgccagcgtgccgac
gggctggtcgagtacctgggccgcatcgaccatcaggtcaagattcgtggctttcgcatc
gagctgggcgagatcgaaacccgtctgctcgaacacccggccgtgcgcgaagcggtggtg
ctggcgctggaggcgctgagcggtaaacagctggtggcgtacctggtcagcgatgcggag
cacggcgcgttgcgcgacgcgctgaaagcgcacctcaaggcgcagctaccggactacatg
gtgcctgcgcacctgatcgtgctcgacagcatgccgctcaccgccaacggcaaacttgac
cgccgcgccttgccgcagcccgaccccgaggcgaatcgtcaacagtacgtggcgccacgc
accgcactgcaaagcaccctggccgccatctggtgcgcggtgttgaacgtgcagcaggtt
ggcctcgacgacaacttctttgagctgggcggcgattcgatcctgtcgatccaggtggtc
agtcgcgcgcgtcaggccgggattcatttcagcccgcgcgacctgtttcagcaccagacc
gtgcagaccctggccgccgtcgccacgcgcgccgagcaggtcatggccgagcaaggcgtg
ctcacgggtgcctcggcgctcacgccgatccagcactggttcttcgacagcgacatcccg
gcgcgcgagcactggaaccagtcgttgctgctcaagccgctgcaactgcttgaccctcat
cgcctggagcaggcgttgctggcggtactggagcatcacgatgcgctgcgtctgagcttc
acccggcgcgatgcccagtggcacgccgaacacttgggcgtgccactcgggggtgcgttg
atgcaggcgcaggtgaaggacatggcgcagtgcgccgcgctgttcaccgagacccagcgc
agcctcgacctgcaacacggcccgttgctgcgcgcgttgctgattgatggccccgagggg
cagcagcgattgctgatcgcgatccatcacctggtggtcgatggcgtgtcgtggcgcgtg
ttgctcgaagacctgcagaacgtttatcgccaactgagcgacggccgctccgtcagcctg
ccggccaagaccagtgcgctgcgcgaatgggcggcacgcttgcaggcgtatgcccatagc
gaatccctgcgtgaagagttgagcctgtggcaacgccagttggccgggccccgcgtgctg
ttgccggtggcgcggcctcagggcgcgttgcgtaaccgcgatgccgagacggtcagcgtg
cgcttggatgccgagcgcacccgccacctgttgcagcaggcgccgagcgcttaccgcacc
caggtcaacgacctgctgctgaccgccctggcacgggtggtgtgccgctggagcggccac
gactcggcagtgatccaactggagggccatggccgcgaagcactgttcgatgacatcgac
ctgacccgcagcgtcggctggttcaccagtgcctatcccgtgcgcctgacgccagcggct
gcccagggcgattcgatcaaggcgatcaaggagcaactgcgcggtgtgccgcacaaaggc
ctgggctacggcgtactgcgttatctggccgacgacctgtgcaaacagaccctgatggcg
ctgccggatgcgcccattaccttcaactacctcggccagttcgaccagagctttggcagt
gacgcgctgttccatccgctggatgagccggccgggctggcgcatgatccggacgcgccg
ctgcccaatgagctgagtgtcgacagccaggtatacggcggcgagttggtgctgcgctgg
accttcagccgcgagcgccatacaccgcagaccattcgcgcgttggccgaggggtatctg
gccgagctgcagggcctgatcgaacattgcctggaagacgaggctgttggcctcacgccg
tccgacttccccctggcgcacctgaaccaggcgcagctcgacagcctgccggtggccgcc
agccggatcgaagacgtctacccgctgacgccgatgcaggaaggcctgctgctgcacacc
ctgctcgaaccgggcaccggcctgtattacatgcaggaccgctaccgcatcaacagcgtg
ctcgaccccgagcgtttcgcccaggcctggcaagcggtgatcgcgcgccacgaagccctg
cgtgcgtcgttctgctggaacgtcggcgaagacatgctgcaagtgatccacaaacccggc
agcgcgccgatcgagtacctggactggagccgcgatcccgaggacgagcaagagccgcgc
ctgcaagcgttgctcaagcaggagcgcgaaaccgggttcgatctgctcaaccaggcgccg
ttccacctgcgcctgattcgcgtgggccaagcgcgctactggttcatgatgagcaaccac
cacatcctcatcgatgcctggtgccgttcgctgctgatgaacgacttcttcgagatctat
ctcgccctgggcgaaggccgcgcagcgcaactggccacgccgccacgttatcgcgactac
atcgcctggctgcaacgccaggaccttaacgaagcgcgccagtggtggcagcgcaatctg
caggggtttgaacgtaccacgccgatccccagcgaccggccattcctgcgcgaacatgca
ggccacagcggcggcatgctggtgggcgactgctacacccggctggatgcctgcgacggc
gcgcaactgcgcgaactggcccaggcccatcaactcaccgtcaatacctttgcccaggcg
gcatgggcgctggtattgcggcgtttgagcggcgagcgtgacgtgctgttcggcgtcacc
gtggccggccgcccggtggacatgcccgagatgcaacgcaccgttggtctgttcatcaac
agcatcgcgctgcgcgtgaaactgcccgaggacgatcagccttgcagcgtgcgccagtgg
ttgagcggcctgctcgacagcaacatgcaactgcgcgagtacgaatacctgccgctggtg
acgatccaggaacacagcgaactgcccaagggccagccgctgttcgatagcctgttcgtg
ttcgaaaacgccccggtggacacctcggtgctggaccatgcgcaaagcctgaacgccacc
tcggattccggtcgcacccacaccaacttcccgctgacggcggtgtgctatccgggcgat
gacctcggtttgcacctgtcctacgaccagcgctacttcgatgaaaccaccgtgcaaggc
atgctcggcgagttcaaacgtctgctgctggcgctgatgcagggctttcatggcgacatg
gccgacctgccgctgatcggcgatcaggagcgtgcgttcctggtggaaggctgtaaccag
agcgcacaggattacccgctggcgcgcagctatgtcgaattgttcgaagagcaggtggcg
cagcatccgcagcgcattgctgccagttgtctggaccagcgatggacctatgagcaactg
aaccgtcgcagcaacggcctgggccatgcgttgatcagcgcgggtgtgggcctggaccag
ccggtggcattgctggccgagcgcaacctcgacctgctgggcatgatcatcggcagcttc
aaggccggtgccggttacctgccgctcgacccgggcctgcccgcccagcggctgagccgc
atcattgagttgagccgcacgccgttgctggtgtgcagcgaggcgtgtcgcgaacaggcc
atcgagttactcgaaggcacccagtgccagttgctggtgtgggaagaggtgccggcccgt
ggcgagaatcctggcatctacagcgcggcggacaatctcgcctacgtgatctacacctcg
ggctccaccggcctgcctaaaggcgtgatggtcgaacagcgcgggatgctcaataaccag
ttgagcaaggtgccgtacctggagctgtcgccggcagacgtcatcgcgcagaccgcttcg
cagagcttcgatatttccgtgtggcaatttctcgcggcgccgctgttcggtgcgcgggtg
gatatcgtgccgaatgccatcgcccatgacccccagggcttgctcgaacatgtgcaggcg
caaggcattaccgtgctggagagcgtgccgtcgctgatccagggcatgctcgcccacgac
cgcatcagcctggacgggctgcgctggatgctgccgacgggtgaagcgatgccgccggag
ctggcgcatcaatggctgcaacgctatccgcagattggcctggtgaatgcctacggcccg
gcggaatgctcggacgacgtggcgttcttccgcgtcgacctggcctcgactcgcggcacg
tacctgccgattggcacaccgaccgacaacaaccgtttgtacctgttggacggcgcgctg
gacctggtgccgcaaggcgcggtgggtgagttgtgtgtcgccggcaccggtgtcggccgt
ggctatgtcggcgatccgctgcgcaccgccccggtgtttgtgcccaacccctttggcgcg
ccgggcgagcgtctctaccgcaccggcgatctggcgcgccagcgcagtgacggggtgttg
gagtacgtcgggcgcatcgaccatcaagtgaaaattcgcggttaccgcatcgagctgggt
gagatccaagcgcgtctgcacgaacaacccgaagtgcgcgacgcggcggtgggcgtgcag
gagggcgccaatggcaaacacctggtgggctacctggtggccgccgacgcggcgcttgac
cctgacgagcgcctggaccgcatcaagcaacgcctgcgcgccgaactgccggaatacatg
gtgccgctgcactggctatggcttgatcgcctgccactcaacgccaacggcaagctcgac
cgcaacgccttgccggaactggaaatcggccaattgcaccgtcagggttacctggcaccg
cgcaacgaactggaaaccacgctggctgcgatctgggccgaggtgctgaaagtcgaacgg
gtaggggtgcgggacaacttcttcgaattgggcggccactcgttgctcgccacacagatc
gcctcgcgggtgcagaaaaccctgcaacgcgatgtgccgctgcgggcgatgttcgagtgc
agcacggtggcagagctggcggagtatatcgaggggttggtgggcaacgagatcagcgtg
gagaaggtggatcggttgagtgatttgatggccgagttggaggggctttaa

DBGET integrated database retrieval system