KEGG   Pseudomonas poae: H045_14660
Entry
H045_14660        CDS       T02456                                 

Definition
(GenBank) periplasmic sensor Signal transduction histidine kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
ppz  Pseudomonas poae
Pathway
ppz01503  Cationic antimicrobial peptide (CAMP) resistance
ppz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H045_14660
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H045_14660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppz01001]
    H045_14660
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ppz02022]
    H045_14660
   01504 Antimicrobial resistance genes [BR:ppz01504]
    H045_14660
Enzymes [BR:ppz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     H045_14660
Protein kinases [BR:ppz01001]
 Histidine kinases
  OmpR family
   H045_14660
Two-component system [BR:ppz02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   H045_14660
Antimicrobial resistance genes [BR:ppz01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    H045_14660
SSDB
Motif
Pfam: HATPase_c PhoQ_Sensor HisKA HATPase_c_2 HATPase_c_5 HATPase_c_3 HAMP
Other DBs
NCBI-ProteinID: AGE26997
LinkDB
Position
complement(3362000..3363346)
AA seq 448 aa
MIRSLRVRLMLAAATLAVLFMLGLLPAMQGAFSLALQDSIEQRLASDVTTLISAARVENN
RLLMPAQLPDERFNLTDSRLLGYIYDREGHLVWRSRATQEENINYKPRYDGRGNEFARIR
EANGQEFFVYDVEVKLLGGKSAAFSIVALQPVREYLLTLEGLRENLYLGFGAALLVLLTL
LWLGLTWGLQALRRLSQELDQIEGGTRESLSEQHPRELLRLTGSLNRLLHGEREQRARYR
DSLDDLAHSLKTPLAVLQGVSEDMAQRPADRDQAWVLQSQIERMSQQIGYQLQRASLRKS
GLVRHQVRLEPVLQSLCDTLDKVYRDKRVAVSFNLPDECYVPIEKGALLELLGNLLENAY
RLCVREVRISLLESLEGAELCIEDDGPGVPPDQRARILQRGERLDRQHPGQGIGLAVVKD
IIESYGARLTLGDSPLGGAAFKIHFPAV
NT seq 1347 nt   +upstreamnt  +downstreamnt
ttgattcgctcgcttcgtgtgcgcctgatgctggcggccgctaccctggccgtgctgttc
atgctgggcttgctgccggccatgcagggtgcgttcagtctggcgttgcaggattccatc
gagcagcgcctggcctcggacgtcaccaccctgatctcggcggcgcgggttgaaaacaac
cgcctgctgatgccagcgcagttgccggatgagcgcttcaacctcaccgacagccggctg
ctcggctatatctacgaccgcgaaggccatctggtgtggcgctcgcgggcgacccaggaa
gaaaacatcaactacaagccgcgctatgacgggcgcggcaatgaattcgcgcggattcgc
gaggccaatggccaggaattcttcgtgtacgacgtggaggtcaagctgctcggcggcaag
agcgccgcgttcagtatcgtcgccctgcaaccggtgcgcgaatacctgctgaccctcgaa
ggcctgcgcgaaaacctctatctgggctttggcgccgcgttgctggtgctgctgaccctg
ttatggctgggcctgacctggggcctgcaagccctgcggcggctgagccaggaactcgac
cagatcgagggcggcacccgcgaaagcctcagcgagcagcacccgcgtgaattgctgcgc
ctgaccggctctctcaaccgcctgctgcacggtgagcgcgagcaacgcgcacgctaccgc
gactccctcgacgatctggcccacagcctgaaaaccccgttggcggtgttgcagggcgtg
agcgaggacatggcgcagcgccccgccgaccgcgatcaggcctgggtgctgcaatcgcag
atcgagcgcatgagccagcagatcggctaccagttgcagcgcgccagcctgcgcaaaagc
ggtctggtgcgccaccaggtaaggcttgagcctgtgctgcaaagcctgtgcgacacgctg
gacaaggtgtaccgcgacaagcgcgtggccgtgtccttcaacttgccggatgaatgctat
gtgccgatcgagaagggcgccttgctcgaattgctcggcaacctgctggaaaacgcctac
cgcctgtgcgtgagggaggtgcgtatcagcctgctggaaagcctcgaaggcgccgagctg
tgcatcgaggacgacggccctggcgtgccccccgaccagcgcgcgaggattctgcagcgg
ggcgaacggctggaccggcagcatccggggcaggggattggcctggcggtggtcaaggac
atcattgaaagctatggcgcacgcttgactctgggcgattcgccattgggtggcgcggcg
ttcaagattcattttccggctgtttga

DBGET integrated database retrieval system