KEGG   Pseudomonas poae: H045_20355Help
Entry
H045_20355        CDS       T02456                                 

Definition
(GenBank) serine/threonine protein kinase PpkA
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
ppz  Pseudomonas poae
Pathway
ppz02025  Biofilm formation - Pseudomonas aeruginosa
ppz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H045_20355
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    H045_20355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppz01001]
    H045_20355
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppz02044]
    H045_20355
Enzymes [BR:ppz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     H045_20355
Protein kinases [BR:ppz01001]
 Serine/threonine kinases: Other
  Bacterial family
   H045_20355
Secretion system [BR:ppz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   H045_20355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH VWA_2 Pkinase_fungal TssR Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: AGE28133
LinkDB All DBs
Position
complement(4617815..4620787)
Genome map
AA seq 990 aa AA seqDB search
MNILIPGYDIDGEIGEGAMASVYLATQRSLERKVALKVMAAALAADPSFCERFLREGRTL
ARLSHPHTVTIHDIGNVGELYYMAMEYLPNGTLKERIAAGMTPQQGVTLIRQIASALGYA
HAQGLVHRDVKPANILFRADGTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVLYEILVGKLPYTGTDALSTALAHLTEPLPELPVHHGRYQGVLRKL
LAKDPAERFADAAALLVALDQLPMDSPEATLVRPLPMPMSFDLAGITPESIEIPTARPQP
QVVRQPVVTPTQHRAVSEQRRGPVLALAAVAVAVALAIGGASFWWLSGSDEPARPPAAAV
PKAVTPPAAVAEVDGGQRPLLMAGKKTLFQRVLSKPGAKLASEAGGASGKALPAFSVLYV
YQRKAVGGQPWVRVGAATDGRSDGWLPASQVSDWKQSLVLKFTERSGRAPVMFLRQPGEV
EKLLADPSAAKNALANAQKNSDDNQQVLALEPAASAVPQNQFYLLPIFDSKESFDENGQP
VQLLNVASIDPGSSAVARPAAPAVNADAFRTAVVMVVDTTVSMQPYIDQIRDVVHELQTR
IAERGELDSVSFGLVGFRNSIKKTPGLEYVAKTLISLDQGRDPQRFLDMARQVKASTVSS
HSFNEDAFAGVMQAVEGMDWSGYGGRIILLVTDAGALRKNDPFAATQMNEAEVRQAALGK
QIKIYALHLRTDAGKKTHAGAESQYRILTADANPKIGDLYTPVPGGDVHKLGERVDEIGT
VFANLVHQVRSNTPQPVPLLGAAPSLADKSAAVGYAMHMDFLGRKTASQAPQLVSAWTAD
RDLTNPALPAFQVCVMLTKLQLNDLQQSLKLIVDAARKTQTSPKDFFQEIASASAYMSRD
PQALRKGGNLADGGILGEYLEGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELDSKIRLYE
TFHNDVANWVRFGDAEPGDALYRVPLSTLP
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctgatccccggttacgacatcgacggcgagattggcgaaggcgccatggcc
agcgtgtacctggcaacccagcgctcgctggagcgcaaggtcgccctgaaagtgatggcg
gcggcgctggcggctgatccgagtttctgcgagcgctttctgcgcgagggcaggaccctg
gcgcggctgtcgcacccgcacaccgtgaccatccatgacatcggcaatgtcggtgagctg
tattacatggccatggaatacctgcccaacggcacgctcaaggagcgcatcgccgccggc
atgacgccgcagcagggggtgacgctgatccgtcagatcgcctcggcgttggggtatgcc
catgcccagggcctggtgcaccgtgatgtcaaaccggcgaacatcctgtttcgcgccgac
ggcacggcggtgttgtcggacttcggcatcgccaagtccctcgacgaccgcacccagttc
acccaggccgggtttgccgtgggcacgccgagctacatgagcccggaacaggcgcggggc
caggagatcgatggccgcgccgacctttacgcgctgggcgtggtgctctacgaaatcctc
gtcggcaagctgccctacaccggtaccgacgcactctccacggcgctggcgcacctcacc
gaaccgttgccggaattaccggtgcaccacgggcgttatcagggtgtactgcgcaagctg
ctggccaaggacccggccgagcgattcgctgatgcggcggcgttgctggttgcgctcgat
caactgccgatggactccccggaggccaccctggtgcggccgctgccgatgccgatgagt
ttcgacctggcgggtatcacacccgaatccatcgagatcccgaccgccaggccgcagccg
caagtggtacgccagccggtggtgacgccgacccagcatcgcgcggtgtccgaacagcgc
cgtgggccggtattggccctggccgccgtggcggttgccgtggcgctggccattggcggc
gcgagtttctggtggttgagcggcagcgatgagccggccaggccgccggcggccgcagtg
cccaaggccgtcacgccacctgcggcggtggccgaggtggatggcggccagcgcccgctg
ttgatggctggcaaaaagaccctgttccagcgcgtactcagtaagcccggagcaaaactg
gcaagcgaagcaggcggtgcatccggcaaggcgctgccggcgttctccgtgctctacgtg
taccaacgcaaggcggtcggcggtcagccctgggtgcgcgttggcgccgccaccgatggg
cgcagcgacggttggttaccggcctcccaggtcagcgactggaaacagagcctggtgctc
aagttcaccgaacgttcgggccgtgcaccggtgatgttcctgcgccagcccggcgaggtg
gagaagctgctggcggacccgtccgccgcgaaaaatgccctggccaacgcgcagaaaaac
agcgatgacaatcaacaggtgctggctcttgagcctgccgccagcgccgtgccgcagaac
cagttctacctgttgccgatcttcgattccaaagagagcttcgacgaaaacggccagccg
gtgcagttgctcaacgtagcgtccattgaccccggcagcagcgccgtagcgaggcccgcc
gcgcctgcggtcaacgccgatgccttccgcacggctgtggtgatggtggtggatacgacc
gtgtcgatgcagccctacatcgaccagattcgcgacgtggtgcacgagctgcaaacccgc
atcgccgagcgcggcgagctggacagcgtcagcttcggcctggtgggctttcgcaacagc
atcaagaaaacccccggcctggaatacgtggccaagaccctgatcagcctcgaccagggg
cgtgacccgcagcggtttctcgacatggcacgccaggtcaaggcgtccacggtatcgagc
cattcgttcaacgaagacgcgtttgccggggtgatgcaggcggtggaaggcatggattgg
tccggctatggcgggcgtatcatcctgctggtgaccgatgcgggcgcactgcgcaagaac
gatccgttcgccgccacgcagatgaacgaagccgaagtgcgccaggccgcgctgggcaag
cagatcaagatctacgccttgcacctgcgcaccgatgccggcaagaaaacccatgccggc
gccgagagccagtaccgcatcctcacggctgacgccaacccgaagatcggcgacctgtat
acgccggtgccgggtggcgacgtgcacaagctcggcgagcgcgtggatgagatcggcacg
gtgttcgccaacctggtgcaccaggtgcgcagcaacacgccgcagccggtgccattgctg
ggcgccgcaccgagcctggcggacaagtcggcggccgtcggttatgcgatgcacatggat
ttcctgggccgcaagaccgcgagccaggcaccgcaactggtgagtgcatggaccgccgac
cgtgacctcaccaacccggcgctgccggcgtttcaggtgtgcgtgatgctgaccaagttg
cagctcaacgacctgcaacagtcgctgaaactgatcgtcgatgcggcgcgcaaaacccag
acctcgcctaaagacttcttccaggaaatcgccagcgcctcggcctacatgagccgcgac
ccgcaagccctgcgcaagggcggcaacctggccgacggtggcattcttggcgaatacctg
gagggtctgccgtaccgcagcaagtcgctgaacatgacccaggacttgtggttgtcgttg
agcgtggccgagcaggaagactttatcgacgagctggattcgaaaatccgcctctacgaa
accttccacaatgatgtggccaactgggttcgattcggcgatgccgagccgggcgatgcg
ttgtaccgcgtgcctttgtcgacgctgccgtga

DBGET integrated database retrieval system