KEGG   Cutibacterium avidum: PALO_01045Help
Entry
PALO_01045        CDS       T02632                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pra  Cutibacterium avidum
Brite
KEGG Orthology (KO) [BR:pra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PALO_01045
Enzymes [BR:pra01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PALO_01045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like Thi4 NAD_binding_8 FAD_binding_3 DAO Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGJ76837
LinkDB All DBs
Position
complement(225509..227083)
Genome map
AA seq 524 aa AA seqDB search
MLDNALTTQLKTYLEMVREPIVLVPSPYRGDDATKASKSAQMDELLAEIATLSDKVSVGD
PVDNERTPSFAITSPSSQSDIRFAGLPMGHEFTSLVLALLQVGGHPVKEEQSLIDAVRAV
KGEHHFVTYMSLTCQNCPTVVQALNAMAVLNPNIHHTAVEGGTHTDEVEAKGIASVPAIY
LDGEDWGSGRMDMAEILERLDANAAQGAKENLSERDPYDVLVVGAGPAGAAAAVYAARKG
IRTAMVGSRVGGQVLDTEAIDNLVSVPHTTGPKLADALRAHVNGYDIDVIERQTASTLET
ADGMTTVRLTDGDLRARSVVIATGARWRNLGVPGEEEYRTKGVTYCPHCDGPLFKGKRVA
VVGGGNSGIEAAIDLAGVVDHVTVVEFLDVLKADDVLLRTLKSLPNIDVITSARTTQILG
DGSKVTGLEYEDRTSGEVKTIELAGVFVQIGLLPNTEWLEGAVERTGRGEVVIDERGGTS
VPGVFAAGDCTTQPYKQIIISMGAGATAALGAFDYLIRQNPAQN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacaacgccctgaccacccagctcaagacctacctcgagatggtgcgcgagccc
atcgtcctggtgccctctccctaccggggagacgacgccaccaaggcatcgaagtcggcc
cagatggacgagttgctcgccgagatcgccaccctgtcggacaaggtgagcgtcggcgac
cccgtcgacaacgagcggaccccgtccttcgccatcacctctccaagctcccagagcgac
atccgcttcgccggtctgccgatgggccacgagttcacctccctggtgctggccctgctc
caggtcggtggccaccccgtcaaggaggagcagtccctcatcgacgcggtgcgggcagtc
aagggggaacaccacttcgtcacctacatgtcgctgacctgccagaactgcccgacggtg
gttcaggccctcaacgcgatggccgtcctcaacccgaacatccatcacaccgccgtcgag
ggtggcacccacaccgacgaggtggaggccaagggcatcgcctcggtgccggccatctac
ctggacggcgaggactggggctcgggccgcatggacatggccgagatcctcgaacgtctc
gatgccaacgccgctcagggagccaaggagaacctgtccgagcgcgatccgtacgacgtg
ctcgtcgttggcgctggccctgctggtgccgccgctgccgtctacgccgcccgcaagggt
attcgcacggcgatggtggggtctcgagtcggcggccaggtactcgacaccgaggccatc
gacaacctcgtctccgtgcctcacaccactggcccgaagctggccgacgccctgcgggcc
cacgtcaatggctacgacatcgacgtcatcgagcgtcagaccgccagcaccctggagact
gccgacggcatgacgacggtgcgtctgactgacggcgacctgcgtgcccgctcggtcgtc
atcgcgactggtgctcgctggcgcaacctcggcgttcccggtgaggaggagtaccgcacc
aagggtgtcacctactgcccgcactgcgacggcccactgttcaagggcaagagggtcgcc
gtcgtcggtggtggaaactccggaatcgaggcggcaatcgacctggccggcgtcgtcgac
cacgtcaccgtcgtcgagttcctcgacgttctcaaggccgacgacgtgctgctgcgcacc
ctcaagtcgctgccgaacatcgacgtcatcacatcggcccgcaccactcagattctgggc
gacggctccaaggtgacgggactggagtacgaggaccgcaccagcggcgaggtcaagacc
atcgagctggctggcgtcttcgtccagatcggcctgctgcccaacaccgagtggctggaa
ggcgccgtggagcgcactggccgcggcgaggtcgtcatcgacgagcgcggtggcacctcg
gtgcccggcgtcttcgctgccggtgactgcaccacccagccctacaagcagatcatcatc
tcgatgggtgctggcgcgacggcagcactcggggccttcgactacctcattcgtcagaac
cccgcgcagaactga

DBGET integrated database retrieval system