KEGG   Cutibacterium avidum: PALO_10595Help
Entry
PALO_10595        CDS       T02632                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pra  Cutibacterium avidum
Pathway
pra00473  D-Alanine metabolism
pra00550  Peptidoglycan biosynthesis
pra01100  Metabolic pathways
pra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PALO_10595
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PALO_10595
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PALO_10595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pra01011]
    PALO_10595
Enzymes [BR:pra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PALO_10595
Peptidoglycan biosynthesis and degradation proteins [BR:pra01011]
 Precursor biosynthesis
  Amino acid ligase
   PALO_10595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AGJ78711
LinkDB All DBs
Position
complement(2325605..2326645)
Genome map
AA seq 346 aa AA seqDB search
MAASDRACGSCLAVLGESVSPSLSRRWLNGAMLQPVVVLAGGLSHQRDISLKSGRTVAQA
LRRVGHEVVEADIDSSLIETLRANDGAVVFPMLHGGLGENGALLEVLQLMDIPYVGSGPA
TCRISFDKSIASRTVAAAGVAIPQQAALPHDVFRELGAQTVIRSITERFGLPVIVKPARG
GSSLGVMKVEDAADLPQAIANAYAYDDMAVVEEFVTGTELAIGMITSSEGTRVLPAVEIR
PVGGVYDYSAMYTGGETRLTAPADISDETAEAATQMAQIVQRELDFSGISRVDAIVDGSG
RPVFLEAGAAPGMTATSLVPVAMEAAGLDLGQVCSHLVADVARNHD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttctgatcgagcctgtgggtcctgtctggctgtcttgggagagtcggtgtcc
ccgtcactgtcgcgacgctggttgaatggggccatgttgcaaccagtcgtcgtcctcgcc
ggcgggctcagccatcagcgcgacatctctttgaagtcgggtcgcaccgttgcccaggcg
ttgcgacgagtcggacatgaggtcgtggaggccgatattgactcctccctcatcgagacc
ctgcgcgccaacgacggagccgtcgtcttccccatgctgcatggtggtctaggagaaaac
ggggctcttcttgaagtcctccagctcatggacatcccctatgttggatcggggccggcg
acctgccgcatttccttcgacaagtccattgcgtcacgaaccgtcgctgccgcgggtgtc
gccatccctcagcaggcggctctcccccacgacgtcttccgagaactcggagctcaaacc
gtgatccggtccatcacggaacggttcggacttccagtcattgtgaagccagctcgcggc
ggctcgagcttgggggtgatgaaggtcgaagacgccgctgacctcccccaggccattgcc
aatgcctacgcctatgacgacatggcggtcgtcgaggagttcgtcaccggaaccgaactt
gcgattggcatgatcacaagctctgagggaacgcgagtgctccctgccgttgagatccgc
cccgtcggtggggtttatgactactcggcgatgtacaccgggggcgagacccgtttgacg
gctccggccgacatcagtgatgagactgccgaagccgcaactcagatggcccagatcgtc
cagcgggagttggatttctctggcatctcccgtgtggacgccatcgtcgacgggtctgga
cgtccggtgttcttggaggctggtgctgctcccggcatgacggccacgtccctcgtgccc
gtcgcgatggaagccgctggcctggatctcggccaggtgtgctcgcaccttgtcgctgac
gtcgcccgtaaccatgactga

DBGET integrated database retrieval system