KEGG   Cutibacterium avidum: PALO_10610
Entry
PALO_10610        CDS       T02632                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pra  Cutibacterium avidum
Pathway
pra00620  Pyruvate metabolism
pra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PALO_10610
Enzymes [BR:pra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     PALO_10610
SSDB
Other DBs
NCBI-ProteinID: AGJ78714
LinkDB
Position
complement(2330063..2333443)
AA seq 1126 aa
MATQAHTDSVNLRLALNGLPLPTAARASDIDVVAPVLARQRELRREIPELLCPADRRIQA
FIDRYLGEDSPVHPHLPETTLTLDEPGLARAFSLPVDGDEFTSDLVASYRVANGVLHNPR
NDRRTTAGVFHVAEGGLAIPDDKKAVPIDVFARLLDLAFQAPPEHTLLPYTSTQPVERQA
HTWVSLLLRPLVVPWIPGFVSERRMEVRFFAPGGLVSNLDFVEGIFGNAGDPLLPANDSA
LEPSGWTGHSGCVILAPHLNLVRKVDLGLPHIDQATDRQRRDGMCWSDESELYNEGKPFK
LCARDDSGVILTIVADNYFGYCKKEVKTQISYSANLFGLAEEEHSGGARAYRSHNQGQEY
ATPTCERTVADVVAEDPDDFEMLDKGHAKVLGIDNVLLVPGGTKFSLRDGTVTWDDGAQS
IPMRADTEYVSPDGYRMKMIHNEADNQWYLEGTYGESTTLHKCCTVSGGGKSEISKAISD
TFLQGNAYAPDFEADMDAVEDILHRDFSSRFADPELNGKDHRPILSAERSVGSVIKLLTP
SSDFTDWYNDWINSIPSFRKELIFTIKRYYKPEWGDDWRSHFTVAPTNGRHGNMVRLDGQ
KILVSMARVGFQPDGSWRLFTLRHDYAPAVKVQTEDDMTASVITSPGMVTGPEGLSRKVV
ANCEALLFQRPDDAIHRGYDTQTERDMSERDLFISNYQPLTRDDVRAMRDDVVAFSKFTK
PMREALSNFADSDPSEEPKYVASSADPRLIDGVRSRNPRYLQVRPDIAKPRETAIANLAS
HLYHGRRVNEPLPLPVDVVAAGRRNNPPEDKIPALCAYNPLHYMELPELFMEFISSMTGK
SPSTTGAGSEGALTKAPFNALPAVFDLNSSFLSFVLSGYDGWLSSAGFIGPNVEVAHDIS
LLVPEIFCRMSPEERDAKTLIEGGYLEKMEDFEKDGELILASRLGYRMTEKFMRAYFGRI
FLHPDTVFTPEMLRPELQDAEIFADSVRTISMTHARVAKAYFADGTISLAVPPIRALLEI
MATGTCEEGWTLDDPELREMFTRESVLASDWYAERLDAKQAEDARRSEMGIAQLEEFMAD
PRNAAACEEIDVQARLDHVRRFHDRAVTEEYRQQLVGTLGRQVNFR
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggccacccaagctcacaccgactccgtgaacctcagattggcgctcaacggcctgcca
ctgccgacagccgcgcgcgcctccgacatcgacgtcgtcgccccggtacttgctcgtcaa
cgggaactcagacgggagatccctgagctcctctgcccggctgaccgacgcatccaagca
ttcatcgaccgttacctcggcgaggactcccccgtccatccccacctgcccgaaaccacc
ctgactctcgatgagcccggcctggcccgagccttttccctccccgtcgacggtgacgag
ttcacctccgacctggtcgcgagttaccgggtcgccaacggcgtgctccacaacccgcgc
aacgatcgtcgcaccaccgccggcgtcttccatgtcgcggagggcggtctggctatcccc
gacgacaagaaggccgtcccgatcgacgtcttcgcccgtctcctcgacctcgccttccag
gccccgccggagcacaccctgcttccttacacgtccacccagccggttgagcgtcaggcc
cacacctgggtgtccctgctgctgcgtcccctcgtggtgccgtggatcccgggcttcgtc
tccgagcgtcgcatggaggtccgcttcttcgctcccggcggtctggtctccaacctcgac
ttcgtcgaaggtattttcggcaatgccggggacccgctgctgcccgccaacgactccgct
ctggagccctcgggatggaccggccacagcggctgcgtcatcctggccccgcacctcaat
ctcgtccgcaaggtcgacctcggtctgcctcacatcgaccaggccaccgaccgccagcgt
cgcgacggcatgtgctggtccgacgagtcggagctctacaacgagggcaagccgttcaag
ctgtgcgcccgtgacgattccggggtcatcctcaccatcgtcgccgacaactacttcggc
tactgcaagaaggaggtcaagacccagatctcctactccgcgaacctcttcggactggcc
gaggaggagcactccggtggtgcccgcgcctaccgttcccacaaccagggccaggagtac
gccaccccgacctgcgagcggacggttgccgacgtcgttgccgaagacccggacgatttc
gagatgctcgacaagggtcacgcgaaggtcctcggcatcgacaacgtcctgctggtaccc
ggcggaaccaagttcagcctgcgcgacggcaccgtcacctgggacgacggcgcacagtcg
atcccgatgcgcgccgacaccgagtacgtctcgcccgacggctaccgcatgaagatgatc
cacaacgaggccgacaaccagtggtacctcgagggtacgtacggcgaatcgacgaccttg
cacaagtgctgcacagtgtccggcggcggcaagtcggagatctccaaggcaatctcggac
accttcctgcagggcaacgcctacgccccggacttcgaggccgacatggacgccgtcgag
gacatcctgcaccgggatttctcgtcccgattcgctgaccccgagctcaacggaaaggac
caccgtccgatcctgtcggcggagcgttccgtcgggtcggtcatcaagctgctcaccccg
tcgtcagatttcaccgactggtacaacgactggatcaactccatcccgtcgttccgcaag
gaactcatcttcaccatcaagcgctattacaagcccgaatggggtgacgactggcgctcc
cacttcacggttgcgccgacgaacggccgccacggcaacatggtgcgcctcgacggtcag
aagatcctggtgagcatggctcgcgtcggtttccagcccgatggctcgtggcgtctgttc
accctgcgccacgactacgcgccagccgtcaaggtccagaccgaggacgacatgacggcc
tccgtcatcacctcacctggaatggtcaccgggccggagggcctgtcgcgcaaggtcgtc
gccaactgcgaggcgctcctcttccagcgtcctgacgacgccattcaccgtggctatgac
acccagaccgagcgcgacatgagcgagcgcgacctcttcatctcgaactatcagcctctg
acccgcgatgacgtcagagcaatgcgagacgacgtggtggccttctcgaagttcaccaag
ccgatgcgcgaggccctgtcgaatttcgccgactccgatccttccgaggaaccgaagtac
gttgcctccagtgccgatccgcgtctcattgacggggtgcgctcgcgtaacccgcgctac
ctgcaggttcgccccgacatcgcgaagccgcgcgaaacggcgatcgcgaacctggccagc
cacctgtaccacggccggcgggtcaacgaaccgctgcctctcccggtcgacgtcgtcgct
gccggtcggcgcaacaacccgcccgaggacaagatccctgccctgtgcgcctacaacccg
ctgcactacatggagctgccggagttgttcatggagttcatctcttccatgaccggcaag
agcccctcgacgacgggcgccggttcggagggtgcactgacgaaagccccgttcaacgcc
ctcccggcagtcttcgacctcaactcctccttcctgtccttcgtgctgtccggttacgac
ggttggctgtcctcggctgggttcatcggacccaacgtcgaggtggcccacgacatctcc
ctgctcgtaccggagatcttctgccggatgtcgccggaggagagggatgccaagaccctc
atcgagggcggatacctggaaaagatggaggacttcgagaaggacggcgagctcatcctc
gcgtcccgtctgggctaccgcatgaccgagaagttcatgcgcgcctacttcggccgaatc
ttcctgcatcccgacacggtcttcaccccggagatgctgcgtccggagctacaggacgcc
gagatcttcgccgattcggtgcggacgatctcgatgactcacgcccgggtggcgaaggct
tacttcgctgatgggacgatctcgcttgccgtgccgccgattcgggccctgctcgagatc
atggcgaccggcacctgcgaagagggttggacccttgacgatcctgagctgcgtgagatg
ttcactcgcgagtccgtgctggcctccgactggtacgccgaacgcctcgacgccaagcag
gccgaggatgcgcgacgctccgagatgggtattgcgcaactcgaggagttcatggctgac
ccgcgcaacgcagccgcctgcgaggagattgacgtccaggctcgcctggatcacgtccgc
cggttccatgatcgggccgtgaccgaggagtaccgccagcagctggtgggaaccctcggc
cgacaggtcaacttccgctga

DBGET integrated database retrieval system