KEGG   Cutibacterium avidum: PALO_10965Help
Entry
PALO_10965        CDS       T02632                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pra  Cutibacterium avidum
Pathway
pra00010  Glycolysis / Gluconeogenesis
pra00030  Pentose phosphate pathway
pra00051  Fructose and mannose metabolism
pra00052  Galactose metabolism
pra00680  Methane metabolism
pra01100  Metabolic pathways
pra01110  Biosynthesis of secondary metabolites
pra01120  Microbial metabolism in diverse environments
pra01130  Biosynthesis of antibiotics
pra01200  Carbon metabolism
pra01230  Biosynthesis of amino acids
pra03018  RNA degradation
Module
pra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PALO_10965
   00030 Pentose phosphate pathway
    PALO_10965
   00051 Fructose and mannose metabolism
    PALO_10965
   00052 Galactose metabolism
    PALO_10965
  09102 Energy metabolism
   00680 Methane metabolism
    PALO_10965
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PALO_10965
Enzymes [BR:pra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PALO_10965
Protein phosphatases and associated proteins [BR:pra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PALO_10965
Messenger RNA biogenesis [BR:pra03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PALO_10965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AGJ78774
LinkDB All DBs
Position
complement(2411687..2413951)
Genome map
AA seq 754 aa AA seqDB search
MRVDDELRLTPTLPDGRGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQG
MIDGGDGIRKFGWDDVGSILNRGGTVIGTFRCKAMRERSGRLKAVQNLLEHGIDRLVVIG
GDGSLTGLDVLRTEWTDLVAELVDTGRVSPEVAREHPSLMIAGLVGSIDNDLVGSDMTIG
ADTALHRIVDAIDDLTSTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPED
GWEDRMCAELKRGRQSGRRDSIVIVAEGATDRAGNRITSEYVRQVLENKLGEDARVTILG
HVQRGGRPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGANRIHRLPLVKAVADTKS
VPGLIEQGRYNEAMRMRGRSFVEMDAIFTELSEPARTETEGVEDADRKRIAIMHAGGPAP
GMNTAARAAVRLGISRGHTVIGIHNGFVGLAAGDMSELAWGDVEGWAGEGGAELGTRRET
PSTRDLYAVSRALEDNHIDALLVIGGYSAYEGIHTMTTERDRYPAFRIPTVCIPASIDNN
LPGSELSIGADTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERI
YTNEDGISLDDLANDVHWLRESFAHGRRLFLAVRNENASRNYTTDFIARLLEEESHGMYD
VRQVVLGHMQQGGSPSPFDRLLANRLAYRALNLIDDELAAHQDGPWFIGVNESDMRPSKM
ETMPSLVDSAHRRPREQWWLTMSPVGRTVSDEVR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgttgatgacgaattgaggcttacccccaccctccccgacggtcgtgggttgcgc
atcggcatcctgaccagcggtggcgacgcccagggcatgaatgccgctgtccgcgccgtg
gtgcgctctgcattgagcgtgggagccgaggtctatgcgatctacgagggctaccaaggc
atgatcgacggaggcgacggcatccggaagttcggatgggatgacgtcggttcgatcctc
aaccgtggcggcaccgtgatcggcaccttccgctgcaaggcgatgcgtgaacgctcaggt
cggctgaaggccgttcagaacctcttggagcacggaatcgatcgtctcgtcgtcattggt
ggcgatggttcgctcactggtttggacgtgttgcgcaccgagtggaccgatctcgtcgcc
gaacttgtcgacacgggtcgggtgagccccgaggtggcccgcgagcacccctccctcatg
atcgcgggactcgtcggttccatcgacaacgatctcgttggatccgacatgaccatcggc
gcggacacggctctgcaccgcatcgtcgatgccattgacgacctcacctccaccgccgcc
agccaccagcgatccttcgtcgtcgaggtaatgggtcgtcactgcggctatctcgccctc
atggcggcagtcgccggtggagccgactatgtgctcatcccggagcgcccaccggaggac
ggctgggaggatcggatgtgtgccgagctcaagcgcggccgacagtcggggcgccgggac
tcgatcgtcatcgtcgccgaaggagccaccgatcgcgccggtaaccgcatcacctccgag
tacgtccgtcaggtcctcgagaacaagctcggggaggacgcccgcgtcaccatcctgggc
cacgtccagcgcggcggacgcccctctgcctacgaccgttgggcttccacctggctcggc
taccacgccgttcacgaggtcctttcgacgaccccggaggccgagggacgcgtcatcgga
accggcgcgaaccgtatccaccgtctacccttggtcaaggccgtcgccgacaccaagtcg
gtgcccggtctcatcgagcaggggcgttacaacgaggccatgaggatgaggggacgctcc
ttcgtcgagatggacgccatcttcaccgagctcagcgagccggctcgcaccgagaccgag
ggagtcgaggacgccgaccgcaagcggattgcgatcatgcatgccggcggccctgccccg
ggcatgaacactgctgcccgcgcggccgtccggttgggcatttctcgcggccacaccgtc
atcggaatccacaacggattcgtcggcctggctgccggggacatgtcggaactggcctgg
ggcgacgtcgagggctgggccggggaaggcggcgctgagctgggcacccgccgcgaaacc
ccgagcacccgtgacctctacgccgtcagccgcgcactggaggacaaccacatcgacgcc
ctgctcgtcatcggcggatactcggcctacgaaggcatccacaccatgacgacggaacgg
gaccgctaccccgccttccgcatcccaacggtgtgcatcccggcctcgatcgacaacaac
ctccccggttccgagctgtccatcggtgccgacaccgccctcaacgtcatcgtcgaggcg
atggacaagatcaaggagtccggcatcgcctcgcgtcggtgcttcgtcgtcgagacgatg
gggcgcgactgcggatacctcgccctgatgtccgggatcgccgccggtgccgagcggatc
tacaccaatgaggacggcatctccctggacgatctggccaatgacgtccactggttgcgg
gagtccttcgcccacggacgacgtctcttcctggccgttcgcaacgagaacgcctctcgc
aactacaccaccgacttcatcgctcgactgctggaggaggaatcccacggcatgtacgac
gtgcgccaggtggtgctggggcacatgcagcaaggtgggtcgccctctcccttcgaccgg
ttgctggccaatcgtctcgcgtatcgcgctctcaacctcattgacgacgagttggccgcc
caccaggacgggccgtggttcatcggtgtcaacgaatcggacatgcgccccagcaagatg
gagacgatgccttccctcgtcgactccgctcaccgtcgtccccgcgagcagtggtggctg
acgatgtcgccggtgggacgaacggtgtccgacgaggtgcgctga

DBGET integrated database retrieval system