KEGG   Pragia sp. CF-458: EKN56_08460
Entry
EKN56_08460       CDS       T06157                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
prag  Pragia sp. CF-458
Pathway
prag00480  Glutathione metabolism
prag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EKN56_08460 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:prag02000]
    EKN56_08460 (gstA)
Enzymes [BR:prag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EKN56_08460 (gstA)
Transporters [BR:prag02000]
 Other transporters
  Pores ion channels [TC:1]
   EKN56_08460 (gstA)
SSDB
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_N_5 Glyco_transf_8C
Other DBs
NCBI-ProteinID: QBH96428
UniProt: A0A411WJU1
LinkDB
Position
1927853..1928458
AA seq 201 aa
MKLYYKPGACSLSPHIILNESGLNYSVEKVDLATKKTEHGADFLAVNPKGQVPTLELNDG
SILTEGVAIVQYIAHKVPGKHLMPGAGTPEYYHAIEWLNFVSTELHKGFSPLFNPQTPEE
YKKIAKEKLLKQFTYVDSVLEKQDYVLGASFSVADAYLFTVTRWAAAVKLDLSALKSLAA
YMERIAARPATAAALKAEGLH
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaattatattataagccaggtgcctgttcgttatcccctcacatcattctgaatgaa
agcggccttaactactcagtagaaaaagtggatttagccaccaagaaaactgagcatggt
gcagactttttggccgttaacccaaaaggccaagtccctaccctggaattgaatgatggc
agtattttgactgaaggtgtggctattgttcagtacattgcacataaagttccgggtaaa
cacctgatgccaggtgcaggaacccccgagtattaccacgctattgaatggctgaacttt
gtttcaaccgaactgcacaaaggctttagcccgctgttcaatccacaaacacctgaagaa
tataagaaaattgctaaagagaaattactcaagcagtttacctatgttgatagcgtactg
gaaaaacaagactatgttttaggcgcttcattcagcgtagcggatgcctatctgtttacc
gtgacccgttgggctgcagcggtaaaactggatctaagcgcattaaaatcactggctgcc
tatatggaacgaattgccgccagaccagcgacagctgctgcgcttaaagcagaaggctta
cattga

DBGET integrated database retrieval system