KEGG   Pieris rapae (cabbage white): 110991577Help
Entry
110991577         CDS       T05162                                 

Definition
(RefSeq) alpha-amylase 2-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00500  Starch and sucrose metabolism
prap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110991577
Enzymes [BR:prap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     110991577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 110991577
NCBI-ProteinID: XP_022112672
LinkDB All DBs
Position
Unknown
AA seq 503 aa AA seqDB search
MEKLFTFITFATCLLVTSAYKNPYFAERRSVIVHLFEWKWDDIALECERFLGPRGFGGIQ
ISPPNENVIIGASNRPWWERYQPLSYVLVTRSGDERQFTEMVRRCNNAGVRIYVDAVINH
MTGEPRDNIGTAGNTANFREWYYPAVPFTREHFNWPPCGIEGSDYNNNAWRVRNCELVGL
KDLDQSKEHVRRMIVEFMNKLIHLGVAGFRIDAAKHMWPEDLRIIYDRLDNLNTAHGFPR
NARPYIYQEVIDYGGEAVSRDEYTPLGAVTEFKAGMDLSNAFRGNNQLRWLSSWGPNWGL
LAHGDALTFIDNHDNERGHGGGGGVLTYKQSRLYKGAVAFLLAHPYGEPQIMSSFDFVDS
EIGPPMDRFENIVSPSINSDGSCGNGWICQHRWRQIYAMVAFRNAAGKRALNNWWDNGSN
QIAFSRGDRAFIAFNNDGWSLNQNLQTGLPGGTYCDVISGDKVNNSCRGKTVIVSGDGRA
HISIGPQDYDLMLAIHVGPESRL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttatttacctttataacttttgctacatgcctattagtaactagtgcttac
aagaacccgtactttgcggaacgaagatcggtgatagttcacctctttgagtggaaatgg
gatgatatagctttagagtgcgaacgttttctaggtcctcgtgggttcggaggtattcag
atatcacccccgaatgaaaatgtaataattggggcaagtaaccgtccatggtgggaaaga
taccagccgctgtcttatgtactagtcactaggtctggagacgagcgtcagttcactgaa
atggtccgccgatgcaataatgctggagtcagaatctacgtggatgccgtaatcaaccac
atgactggagagcctcgcgataacattggtacagctggaaacacagctaattttagggag
tggtattacccagctgtgcctttcactagggaacacttcaactggccaccctgcgggatt
gaaggttctgattataataacaatgcttggagagtccggaactgtgaattagttggatta
aaagatttagaccaatccaaagaacatgtacgccgaatgattgtcgaatttatgaataaa
cttattcacttaggagttgcggggtttagaatcgacgcagcaaaacacatgtggcctgaa
gacctgcgcattatatacgacagactcgacaacttgaatacagcccatggctttccaaga
aacgcgcgcccatacatctaccaagaagtcatagactatggtggcgaagctgtcagcagg
gacgaatatacacctctcggagctgtcacagagtttaaagccggcatggatttgagcaat
gcgttcagggggaataaccagctcagatggcttagttcttggggtcccaactggggtttg
ttggctcatggggatgccttgaccttcattgataatcatgataacgaaagaggtcacggt
ggtggagggggtgttttgacatacaagcaatctagactctataagggagctgtagcattt
ctgttggcccacccgtatggtgagccgcaaattatgagtagcttcgactttgttgactcc
gaaattggaccaccgatggatagattcgaaaatattgtttcgccttctattaattccgat
ggttcatgcgggaatgggtggatatgccaacatcgctggcgccagatttatgccatggtg
gcatttagaaatgctgctggtaaaagagcactgaacaattggtgggataatggcagcaat
caaatcgcatttagcagaggtgacagagcattcattgcgtttaacaacgatgggtggagc
ttaaatcaaaatttgcagacaggtcttccaggtggtacatactgtgacgtcatatccggt
gataaagtgaataactcctgtagaggcaagaccgtcatagttagtggtgatggacgggca
cacatctctattggaccccaagattacgacctcatgttggccatacacgttggtcctgag
agtcgtctgtaa

DBGET integrated database retrieval system