KEGG   Pieris rapae (cabbage white): 110991611Help
Entry
110991611         CDS       T05162                                 

Definition
(RefSeq) uncharacterized protein LOC110991611 isoform X1
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:prap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110991611
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prap03400]
    110991611
Enzymes [BR:prap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     110991611
DNA repair and recombination proteins [BR:prap03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     110991611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 110991611
NCBI-ProteinID: XP_022112738
LinkDB All DBs
Position
Unknown
AA seq 1141 aa AA seqDB search
MDAADPLRTARQEDGEEKPKAAESQDDGYETSNSGEARRKPSSAEGSPAPVPPRTPPPEP
PFEPLLQRPFPSPYRHFEPPAPPPHHDPEPYQHFPFPKYNQDAYFKREPEAPYDMSQQMP
HQFGKRSEDLYNGIKQECEDPYSFVEDDAMCAMLGQQHHMPPHMQHHEHLPHQHPHMQMH
PQQMMLNQPKKRGRKKKIKDENGMEIKTEGLEGALIPRPVKERKKHDRFNGMSEEEVSRR
TLPDHLAENLDIIIIGINPGLFAAYKGHHYAGPGNHFWKCLYLSGLTREQMSADEDYKLL
NFGIGFTNMVARPTKGSADLTRREIKEGSAILLEKLQTFRPKVAVFNGKLIYEVFSGKKD
FCFGKQPDTIAGTNTYMWVMPSSSARCAQLPRAADKVPFYAALKKFRDYLNGLVAHVDEA
ELVFPDNTSRRPQEEMEIRSTSIHRLTMEPEPGDTIILEDGTEVPLKKKRGRPKKIKLEN
GETAPPTPRAPRQPRAPPNLDPNAEQPPKKKRGRPKKIRPEEQQFLMQQQQQPPQPQVSS
DPNTMLQPQLSSMSSLPHEQFMGHGDFPSQMPSPLQQGMLYQHHQQHQQMPDGSPYYQPN
NGGGMDSPLDVSGSLGLGRAGYVSPRGVYASPRSQPYSPTPQRLAATPQPQGQGQQFPSS
PAAFSAPSPPRGSFGSPGVRVGGTFAARSPLYASSPSYQQPSPAPQTQPRFAHEQMAYGR
DPGAQSQTVPYSQSPVPAVGVMSGGNSTPFPAASPAGGTLHSYTPSPAHTPYSHHSSPAA
PAPLTPAYTESHHFAQGGGSNGGSGSYGGELSHEIGAAISSPGVVSPGMATLDFEPPRDD
ASPMGSTDMHPGSNSNSSLSDYNKQPSASGAEVSPGPGASSGAFSNMYEREMPYDADKPH
DYHYAQEQGNGVPESPRLDQLHQHPSMFPSNFNRSTPPVGEETAFSPMASTAFRPAEHHH
PPGSPAEYGGNESGPGTPKPKNQDVSAKSLSGLESLVDQIPSIAEGGNGGGATGGTTEPP
APAVPALPDYTPALYPPYPAYGTPAYGNNGYGGPFVGYGGGWGTQLMRPAPGYLPDWQYG
YAPGYAPYNTPYYNGYAGPPPAHHQQAHYLSASPLLDLHKNAESSVPSVPSVPSVGFGGF
C
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgctgacccgctgcgaacggctaggcaggaggacggcgaggagaagccgaaa
gcggcggagagtcaggacgatggctacgagacgagcaatagcggcgaggcgcggcggaag
ccctccagcgctgagggttcacccgcgcccgtccccccccgcaccccaccgcccgaaccg
cctttcgagccccttttacaacggcccttcccctccccctaccgccattttgaacctcca
gccccgccacctcatcacgacccggaaccataccagcacttcccctttccaaagtacaac
caagacgcgtacttcaaacgagaaccagaggcgccgtatgacatgagccaacaaatgcca
catcagttcggtaaacgcagtgaggacttatacaatggtatcaagcaagagtgcgaggac
ccttactcatttgtggaggacgatgctatgtgtgccatgttgggacagcagcatcatatg
ccgccgcatatgcaacatcacgaacacctcccgcatcagcatccccatatgcagatgcac
ccgcagcagatgatgctgaatcaaccgaagaaacggggtcgaaagaagaaaattaaagat
gaaaatggtatggaaatcaaaacggaaggcttagagggcgcattaataccaagaccagtg
aaggaaaggaaaaagcacgacagattcaatggaatgagcgaagaggaggtgtcaaggcgg
acgctgcccgaccacttagcggagaacctcgacatcatcattattggtattaacccgggt
ctgtttgcggcgtacaagggtcatcattacgcgggtccgggaaaccacttttggaaatgt
ctgtacctctccgggcttacgagggaacagatgagcgctgatgaggattacaagttactg
aacttcggcatcggtttcacgaatatggtggcgagaccgacgaagggttcagcggattta
acgcgacgtgagattaaggaaggctcggcgatactgttggaaaagttgcagacatttcgg
ccgaaagtcgcagtgtttaatgggaagctgatatatgaagttttttctgggaaaaaggac
ttttgcttcgggaaacaacccgatacgatcgctggaacgaatacgtatatgtgggtgatg
ccgtcatcatcagctagatgcgctcaactgccgagagcagcggataaagtaccattttac
gcggcgctcaaaaagttccgggactacttgaacggtttagtagcacacgtggatgaggcg
gaactggtctttccggataatacgagtagacgcccgcaggaggagatggagattcgcagc
acgtccatccacaggctgacgatggagccggaaccgggcgacacgatcatactagaagat
ggaacagaagttcctctgaaaaagaagagagggagaccgaagaagattaagttggagaat
ggggaaactgcgccgccaactccgagggcaccgaggcagccccgcgccccgcccaactta
gatccgaacgccgaacaaccgcccaaaaagaagagaggcagaccgaagaagataaggccg
gaagagcaacagtttttgatgcagcaacagcaacaaccgccgcagccacaggtgagctca
gatccaaatacaatgctccagcctcaattgtcatcaatgtcatcattaccgcacgagcag
ttcatgggtcacggtgacttcccttcgcaaatgccatctccgctccagcaagggatgctg
tatcagcaccaccagcaacaccaacagatgcctgatggatcgccgtattatcagcctaat
aatggcggtggtatggactccccactagacgtatctggttccctgggactgggccgtgcc
gggtacgtgtcccctcgcggggtgtacgcgtccccacggtcgcagccctattcgccgaca
cctcaacggttagccgcaactccacagccgcaggggcagggacaacagttcccctcgagt
cccgcggccttttcggctccgtctccgccgcgggggtcgttcggctcccccggcgtgcga
gtggggggcacttttgccgcgcgctcgcccctctacgccagttctccctcgtatcagcag
ccgagcccagcgccgcaaacgcagccgaggttcgcgcacgagcagatggcgtatggccgg
gatcctggtgcacagtcgcaaaccgtcccctactcgcagtcccccgtgccggcggtggga
gtgatgtcagggggcaacagtaccccgttccccgcggcttccccggcgggtggtacgctg
cactcgtacacgccctcgccggcgcacacgccctacagccaccactcgtcgcccgccgcc
cccgcgcccctgacgcccgcctacaccgagtcgcatcacttcgcacagggtggaggatca
aacggtggttcgggttcatacggtggtgaattatcacatgagatcggcgcagcgatatcc
tcccctggcgttgtttcccccgggatggcaactctagactttgagccgccccgggatgac
gcaagccccatgggaagcacggatatgcatccgggaagcaatagtaattcatccctgtcc
gattataataagcaacccagcgcaagcggggctgaagtgtcccctgggcccggggcctcc
tctggggcctttagcaacatgtacgagagggagatgccctatgacgcagacaagccgcac
gactaccactatgcgcaggagcaaggtaacggtgtcccagagagtccgcggttagatcag
ttacatcagcatccctccatgttccctagtaatttcaatcgatcgactcccccggtgggc
gaagaaactgccttctctccaatggcgtctacagccttcagacctgctgagcatcatcat
ccgcctggttctccagccgaatacggtggtaacgaaagcggacctggcacaccgaagccc
aaaaatcaagatgtctcagccaaaagtctttcagggttggaatccctggtggaccagata
ccctcaattgcggaggggggcaatggtggaggggcgacggggggtacaacggaacccccg
gctcctgcggtacccgctttgcccgactatactccggcgctctatcccccctatccggcg
tatggcacgccggcatatggcaataatggctacggcggtccatttgtgggctacggtggt
ggatggggcacccagctgatgcggcctgccccgggctacctcccggactggcagtatggc
tacgcccctgggtatgcgccatacaacacgccctactacaacggatatgcaggaccgcct
cctgcacatcatcagcaggcccactacctatcagcgagtccacttctagacttgcacaag
aacgcggagtcgtctgtgccctcagtcccgtcggtgccctctgtcggtttcggcggcttc
tgttag

DBGET integrated database retrieval system