KEGG   Pieris rapae (cabbage white): 110993954Help
Entry
110993954         CDS       T05162                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00562  Inositol phosphate metabolism
prap01100  Metabolic pathways
prap04068  FoxO signaling pathway
prap04070  Phosphatidylinositol signaling system
prap04140  Autophagy - animal
prap04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110993954
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110993954
   04070 Phosphatidylinositol signaling system
    110993954
   04150 mTOR signaling pathway
    110993954
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110993954
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:prap01009]
    110993954
Enzymes [BR:prap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110993954
    3.1.3.48  protein-tyrosine-phosphatase
     110993954
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110993954
Protein phosphatases and associated proteins [BR:prap01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110993954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DSPn Y_phosphatase2
Motif
Other DBs
NCBI-GeneID: 110993954
NCBI-ProteinID: XP_022116085
LinkDB All DBs
Position
Unknown
AA seq 697 aa AA seqDB search
MGACLSCRRRERKAPEKRWVPGAVGPAKGAAAERLPRRALLRAMANSISNIKMTNPLKNM
VSKRRKRYMKDGFNLDLAYITDRLIAMGFPAEKLEGVYRNHIDEVYRFLEQMHKDHYKIY
NLCSERKYDSTKFHDRVEIYAFEDHTPPNIELIQPFCESVHSWLSADTRNVAAVHCKAGK
GRTGTMVCCYLLYSGQKATADEALKFYGTKRTHDEKGVTIPSQRRYVEYFASLVRSSLHY
TATKVHIREVVMSPPPALSAAHCTLEITVAQAKLSLKTCLGSHETRRGERYVRVCPLACT
PLSGDVRLDVYAKQKMMRKERLFHLWFNTFFVTACVGSQPVPSPHDSPNLETFKLTLNKW
ELDDAHKDKQHKLYSEDFKVEIIIQKQPETSKFSGHCDRAPSPQSSTASSCSEPDTEPDA
HWDSGEQDLHTPLHLHTPIHLHSSVHMKDTLKPCNHNFDKGDKVTCDKDSGKTGDSLHLG
WAKKCTDYDCKLNDSKETYKFLEHSLCQCGHCDCKSDGQETNSVMSSKNTCDCKDWSNYC
QCKDTPSDISCESRFDFPIKPDSNPKECTGKCRVKERYDIECDCKTYKSDVSNVSTKSCD
SCINGSCNCIGYKADRNRPNFTPIEYSYGEYDSNFESKKTESTESDKEGSIPKVGSDQSM
DEKRSKPRLSLGEMRASWREFSGKFGESRKKKNKHDC
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatgcctgagctgccggcgccgtgagcgaaaggcacccgaaaagcgttgggtg
ccgggcgcggtcgggcctgctaagggcgcggcggctgagcgtctcccccggcgcgccttg
ttacgagccatggccaactccatttcgaacatcaagatgacgaaccctctgaaaaacatg
gtcagcaagcgccggaaacgatatatgaaagatggcttcaatttggacttagcttatata
acagacaggctgatagccatgggtttcccagcagagaagttggagggcgtttaccggaat
cacattgatgaggtgtacaggtttctggagcagatgcacaaggaccactacaagatttat
aacctctgcagcgagaggaagtacgactccacgaagtttcatgatagggtggaaatatac
gcttttgaagaccacacgccgccgaatatcgagctgatccagccgttctgcgagtcggtt
cattcgtggctcagtgccgacaccagaaatgtggcggcagtgcattgtaaagcaggaaaa
ggcaggacaggaacaatggtatgctgttacttattgtacagcgggcagaaggcgactgca
gatgaagcgttgaagttctatggcactaagaggactcacgacgagaaaggtgtgacgata
ccctctcaaaggcggtacgtggagtactttgcctcgctggttcgctcgtccctccactat
acggccactaaggtgcacatacgagaagtcgtgatgtcaccgccgcctgcactctccgct
gcccactgtaccttggagatcactgttgcgcaggcgaagttgtcacttaagacgtgcctg
ggtagtcacgagacgcgacgcggtgagcgctacgtgcgcgtgtgtccactcgcgtgcacg
cccctcagcggcgacgtgcgcctggacgtatacgccaagcagaagatgatgcgcaaggag
aggctcttccacctctggttcaacaccttcttcgtcaccgcctgcgttggctcgcagccc
gtgccctcgccgcacgatagtccaaacctggagaccttcaagctgaccttgaataaatgg
gagttggatgacgcgcacaaggacaagcaacacaaactttatagtgaggactttaaggtg
gagataataatccagaagcaaccagaaacgtcaaagttcagcggtcactgcgacagagcg
ccttcgccccagtcctcgacggcttcctcgtgttcggagcccgacacagaaccagatgcc
cactgggactccggtgagcaggacttacacacacctctacacttacacacacccatacac
ttacactcgagcgtacacatgaaggatacgcttaaaccgtgcaaccataacttcgataaa
ggggataaagttacgtgtgacaaggatagcgggaaaactggtgacagtttacacttgggt
tgggccaagaagtgtacagactacgactgtaaactaaacgatagtaaggagacctataag
tttctagaacattcgctgtgtcagtgcgggcattgtgactgtaaatctgacggccaagag
acgaattccgtcatgtcttccaagaacacgtgcgattgcaaggattggtctaattactgt
caatgcaaagacaccccgtccgatataagctgcgaatcgcgattcgattttccgattaag
cccgattcgaatccgaaagagtgtacgggcaagtgtcgcgtcaaggagcgttacgacatc
gaatgcgattgtaaaacatataaatcggatgttagtaacgtcagtacgaaatcgtgcgat
tcctgtatcaacggctcttgtaattgtatcggatataaggcggacagaaatcgaccgaac
ttcacaccgatcgaatattcgtacggagagtatgattcgaatttcgaatcgaaaaagaca
gagagcacagagagcgataaggagggcagtataccgaaagttgggtccgatcagtctatg
gacgagaagcgatccaagccgcgcttgtctttgggcgaaatgagagcgtcatggcgggaa
tttagcgggaaattcggcgagagccgaaaaaagaaaaataaacatgattgttga

DBGET integrated database retrieval system