KEGG   Pieris rapae (cabbage white): 110995043Help
Entry
110995043         CDS       T05162                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00052  Galactose metabolism
prap00500  Starch and sucrose metabolism
prap01100  Metabolic pathways
prap04142  Lysosome
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110995043
   00500 Starch and sucrose metabolism
    110995043
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110995043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prap04147]
    110995043
Enzymes [BR:prap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110995043
Exosome [BR:prap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110995043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110995043
NCBI-ProteinID: XP_022117699
LinkDB All DBs
Position
Unknown
AA seq 1097 aa AA seqDB search
MPKIPYKVEKQNEEDDYEIVSFEDFCDKPPTAKEDLLTLNDNINYRLFYESGKENKLRDA
GEGSGTNEILSETSLNGPKAPNKKKATFAPFCKSDKTRRVFSGIKPKTRTDDSMREHRYQ
RFSSRPSCLNQLWEKGAALLPGMLVGGLLCALAVATWWAVAGALGGRWGDDHYRKLWERV
HPEEVKKPLTPMTLEKPVITEYRYHDHNNLSTKNRSNATDNKKKDVKKGFLVHSPEVMKE
LCARIVDDEMRFDCHPQNGASEEACVKRGCCWKATDNPYAPYCFYPPQYETYQFINSTEN
KHGMTVYYSRSCDTGYPDQFNVARIDFNYLSNDILQIKISDAEHKRFEPPYPEVPTVYSS
ISEVKYRVNVDSSAVGFKVIRNADNVTIWDAQNTGGFILADKFLQLSAVLPTNYTYGIGE
KQASFLNDMNWKTHTLFNNDQPPGENIHLYGSHPFYLGLETNGNSHGVLLLNSNAMDIAL
QPTPAITYRAIGGILNFYIFLGPSPEDVIAQYMEIIGKPFMPPYWALGFHLCKYNYGSLN
VTRHVWQKNRDAGIPFDVQWNDLDYMSKGNDFTYDTEAFAGLPEFVKTVHEAGMHYVILI
DPGVSASENPGEYPPFDLGLEMNVFVKNSTDMPFVGKVWNRVSTVWPDFTHPNASAYWKE
LMADFHRKVNYDGAWIDMNEPSNFLSGSMYGECSPENLPYKPQTVSEEGLKHKTMCMDAK
HFAGSHFDVHNMYAISEAVATHAALVEIRGKRPLTISRGSSPGLGYYAGHWSGDVFSQWH
DLKASIPQLLSFSLFGIPLMGSDICGFNGDTTPELCKRWMQLGAFYPFSRNHNSDTSKPQ
DPVSLGPIVVEASKRALRMRYRLLPYYYTLFWRAHTDATTVARPLFFEFLNDKRVYNIDT
QFLIGEHIMISAILDEGANTTNAFYPGPNPWYDLNSGKQLALNSWKAINDEEMVAVKGGA
ILPLQDPPAKGPVTTSNTRSLPIQLLLVPDTAGVARGELYWDDGDSLNSYEEEKYSHIIF
KLKGNELTSFIQWWGYGVPAVDTIKVLGQNLIKTVTVNNASSSFTYDKPTKVLKIDVNIN
LDKPFTVKWTNKITQKI
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagattccctacaaggttgaaaaacaaaatgaagaggacgattatgagattgtt
tcgtttgaagatttttgtgacaaacctcccactgcgaaagaagatttattgactctgaac
gataatatcaactatcgcttattttatgaaagtggtaaggaaaataaattaagggatgct
ggagaaggatctggtactaatgagatattatcagaaacatcactgaatggtcctaaagct
ccaaacaaaaaaaaggcaacatttgcgccgttctgtaagagcgacaaaacacgcagggtg
tttagcggcattaaacctaaaacaagaacagatgattcaatgcgagaacatagatatcag
aggttctcatcacggcctagctgcctcaatcagttgtgggaaaaaggagcagcattatta
ccaggaatgcttgtgggtggtttgctttgtgctctggctgtggcaacttggtgggctgtg
gctggggctcttggtggcagatggggtgatgatcattacagaaagctgtgggagcgagtt
catcctgaagaagtaaaaaaaccgctgacacctatgacattggaaaagcccgtcatcacc
gaataccgataccacgaccacaacaacttgagcaccaagaaccgaagcaatgcgactgac
aacaagaagaaagacgtgaagaaaggtttcctggtacattcacccgaggtgatgaaagaa
ctttgtgcacgaattgttgatgatgagatgcgattcgattgccatccgcagaacggggca
agtgaggaggcatgtgttaaacgaggttgttgttggaaagccacagacaatccatacgcg
ccatattgtttttacccgccgcaatatgagacataccaattcatcaacagtacagaaaat
aaacacggaatgacagtttactactcccgatcgtgtgataccggatatccggatcaattt
aatgttgccaggatcgattttaattatttatccaacgacatattgcagattaagatatct
gatgcagagcataagagatttgaacctccgtatcctgaagtgccgacagtctacagttcg
atttcagaagtaaaatatcgcgttaatgttgatagctccgctgtggggttcaaagttata
cggaacgctgataatgttaccatatgggacgctcaaaacacaggtggattcattttggcg
gataaattccttcaattgtcagcggtgctaccaacgaattacacgtatggtataggagaa
aaacaagcgagttttctaaacgatatgaattggaaaactcacacgcttttcaataacgac
caaccgcctggtgaaaatattcatttgtatggatcacatcccttctacttgggtctagag
acgaatggaaatagccatggtgttctgctactcaactccaatgcaatggatatagcgctg
caaccgacgccggccataacctacagagctatagggggtattctaaacttctatatattt
ttgggcccgagccccgaggatgttattgctcaatatatggaaattatcgggaaaccattc
atgccgccatattgggctcttggatttcatttgtgcaagtataactatggatcgttgaac
gtgactcgacacgtatggcagaagaatagagacgctgggataccattcgatgtccaatgg
aatgacctggattatatgagtaaaggcaacgatttcacgtacgacacggaagctttcgct
ggtttaccggagttcgtcaagaccgtacacgaagccggcatgcattacgttatattgatt
gaccctggtgtaagcgcctcggaaaatcctggcgaatatccaccattcgatctgggactc
gaaatgaatgtttttgtgaaaaattcaactgatatgccctttgttggaaaagtatggaac
agagtgtccacggtgtggccagacttcacacacccgaacgcctccgcgtattggaaagaa
ttgatggcggacttccatagaaaagttaactatgacggcgcttggattgatatgaatgaa
ccctcaaatttcctatctggttcgatgtatggcgaatgcagccccgaaaacctgccatac
aagcctcagacagtttccgaagaaggcttaaaacataagacgatgtgtatggacgcgaag
catttcgccggatcccatttcgacgtacacaatatgtacgcgatcagtgaagctgtggct
acgcatgcggctttagtggaaatacgtgggaagcgaccgttgacaatttcccgtgggtcc
tctcctggattggggtattacgcgggacattggagcggggacgtcttcagccagtggcat
gacctcaaggcttctataccacaactactaagcttcagtctcttcggtattcccctaatg
gggtcagatatttgcggattcaatggggacacgacgccagagctctgcaagcgatggatg
caactgggagcattttatcccttctccaggaatcataatagtgatacgtcgaagccccaa
gacccagtgagtttgggcccaattgtggtagaagccagcaaacgcgcccttcgcatgaga
tatcgactccttccatactattacacattgttctggcgagcccatactgatgctaccacc
gtggccagacctttattttttgaattcctaaatgataagcgagtgtacaatatcgatacc
caatttctgatcggcgaacatataatgatatccgccattttggatgagggggcaaacaca
acgaatgcgttttatccaggtccgaacccgtggtacgatcttaattcaggaaagcagttg
gcactgaactcctggaaggctatcaatgatgaggaaatggttgctgtgaagggtggtgcc
atccttccattacaagatccaccagctaagggtcccgtaactactagcaacactcgcagc
ctgcccatacaactattgctcgttcccgatacggcgggggttgccaggggcgaattatac
tgggacgacggggatagcttgaacagctacgaagaagagaaatacagccatattatattc
aagctgaagggaaacgagttgaccagtttcatccaatggtgggggtatggggtacccgcc
gtcgacaccatcaaagtactgggtcaaaatctcatcaaaaccgtcacagtcaacaacgcc
tcgtcgagcttcacgtacgacaaaccgacgaaggtgttgaagattgacgttaatatcaat
ttggataagccttttacggttaaatggacgaataaaatcacgcaaaaaatataa

DBGET integrated database retrieval system