KEGG   Pieris rapae (cabbage white): 110996115
Entry
110996115         CDS       T05162                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04013  MAPK signaling pathway - fly
prap04214  Apoptosis - fly
prap04215  Apoptosis - multiple species
prap04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:prap00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    110996115
   04391 Hippo signaling pathway - fly
    110996115
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110996115
   04215 Apoptosis - multiple species
    110996115
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 110996115
NCBI-ProteinID: XP_022119335
LinkDB
Position
Unknown
AA seq 215 aa
MNLSIKVMRGGISICLLISTLSLAPVLGSRACERGRTWWHRENGVCMPCTRCDPRRLAVK
YPCEVHRDTICQPLYEVRIWPFNTPRKEDSNASDTSDYEYYEYADYGEVTESDDIVWDVQ
TSTLTLAVSGCVVFFVVVLTLSFYHARQWRALKLALKSDVHDLSAKLKLMESGGETRAEP
IVPSDHIYCNIHMGKDALLGSPSAKGGNVYTQEKH
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaatctaagcattaaggtaatgcgaggtggaatatcaatatgcctgctcatcagcact
ctgtcgctcgcacctgtgctcggtagcagagcctgcgagcgtggaagaacctggtggcat
cgcgagaatggcgtctgtatgccatgcacccgctgcgaccctcgccgcctcgctgtcaaa
tatccctgtgaagtacacagggacactatatgtcagcctctatacgaggtccgcatatgg
ccattcaacaccccccgcaaggaggactcaaacgcgagtgacacaagtgattacgaatat
tatgaatacgcggactacggtgaagtgactgagagtgatgatatcgtgtgggacgtacag
acgtccaccttgaccctggctgttagtggttgtgtagttttctttgtggtggtgctgact
ctatccttctaccatgcacggcagtggcgggcgctcaaactagctcttaagtcagatgtg
cacgatttatcagctaagctgaaattgatggaatcaggcggggaaacacgggccgagcct
atcgttcccagtgaccacatctactgcaacattcacatgggcaaagatgctttacttggt
tcaccttcagctaaaggcgggaacgtgtacactcaagaaaaacactga

DBGET integrated database retrieval system