KEGG   Pieris rapae (cabbage white): 110996261Help
Entry
110996261         CDS       T05162                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II-like
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00562  Inositol phosphate metabolism
prap01100  Metabolic pathways
prap04070  Phosphatidylinositol signaling system
prap04310  Wnt signaling pathway
prap04745  Phototransduction - fly
prap04933  AGE-RAGE signaling pathway in diabetic complications
Module
prap_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110996261
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110996261
   04070 Phosphatidylinositol signaling system
    110996261
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    110996261
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110996261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:prap04131]
    110996261
Enzymes [BR:prap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110996261
Membrane trafficking [BR:prap04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110996261
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110996261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_14 EF-hand_like TonB_2
Motif
Other DBs
NCBI-GeneID: 110996261
NCBI-ProteinID: XP_022119542
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MTTYTRSAGVTLKPIEVPKPLQDGEKFIKWDEDSGTGLPVTVRVDPNGFFLYWTDQNMEV
EMLDIATIRDVRTGGYAKLPKDPKIRNVVLIGSQGSLEEKTVTVCHGADFVNITFVNFCC
TRKEIAQLWTEELFNLAYNLNQFNNPTIKFLEKLHTKIVLKADKSGKILVKNIVKLFAQN
KEDKKRVEKALSESGLPTGKTDTICQSKFQFEDFFGFYKSLTQRTEVLNIFNKLTDGKPH
LSATQL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgactacctatactagatcagctggtgtcactttaaagccaattgaagtacctaaacct
ctccaggatggagaaaaattcatcaaatgggatgaggattcaggcacaggcttacctgtc
accgtacgagttgatccaaatggcttctttctctattggacagatcagaatatggaagtt
gaaatgctggacattgcaacaatccgtgatgtccgaactggtggttatgctaagctgcct
aaggatccaaagataaggaacgtggtactgatcggctctcaaggctcacttgaagaaaaa
accgtgacagtctgtcacggcgctgatttcgtgaatattacattcgtgaacttctgttgc
actaggaaggaaatagcacagttgtggacagaagagctgttcaacttagcgtacaatctg
aaccagttcaacaatccaactatcaagttcttggagaaactccacacgaagatcgtcttg
aaggcagataagtccgggaagatattagttaaaaacatagtgaagctgttcgcacaaaat
aaagaagacaaaaagagagtggagaaagcattaagcgagtccggcctacccacgggaaag
actgacaccatctgtcagtctaagttccaatttgaagacttctttggtttctataagagt
ctcacccagcgcaccgaagtactgaatatatttaacaaacttacggacggaaaacctcac
ctatcagctacgcagctc

DBGET integrated database retrieval system