KEGG   Pieris rapae (cabbage white): 110996368Help
Entry
110996368         CDS       T05162                                 

Definition
(RefSeq) trypsin CFT-1-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:prap00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110996368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:prap01002]
    110996368
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prap04147]
    110996368
Enzymes [BR:prap01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     110996368
Peptidases [BR:prap01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110996368
Exosome [BR:prap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110996368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 110996368
NCBI-ProteinID: XP_022119694
LinkDB All DBs
Position
Unknown
AA seq 257 aa AA seqDB search
MKILIILSLALVAVSAVQPRYQRIVGGSVTNIQKYPYAVAMLYSRSGSGTFSQSCGGTII
NNRSVLSAAHCFVGDTTRNWRMRVGSTNSNSGGVVHNSNAIIMHPQYNHRIVDNDVAIVR
SNSAFNFNANVGRGSIASSNYWLPDNAPVWAIGWGRTAWNGPSSNQLREVLLYTVNLQTC
INRYREINNVVNANMLCVGILDVGGRDQCGGDSGGPLLHNNAVVGVCSWGHRECAHPRYP
GVNALVSRYTNWIQANA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctaattattttgagcctcgccttggtcgcggtgtctgctgtgcagccgcgt
taccaaaggatcgtgggtggctcggtgacaaacattcaaaaatacccgtatgccgtcgca
atgttgtattcgcgatctggcagtggcacattctcccagagctgtggtggaaccatcatt
aacaaccgatctgtgctatccgctgcccattgttttgtcggagatactactcggaattgg
cgtatgcgagttggttcaacaaacagtaacagtggtggtgtagtccacaacagcaacgcc
atcataatgcatcctcagtacaatcacaggatcgtcgacaatgacgtggcaattgttcgt
tccaactcagcttttaacttcaatgccaatgtaggcagaggatctattgccagctccaac
tactggcttcctgacaacgcacctgtctgggctatcggttggggaaggaccgcctggaac
ggaccgtcatcaaaccaactccgcgaggtactactctacaccgtgaatcttcaaacttgc
atcaaccgctacagggaaattaacaacgtggtaaacgctaacatgttgtgtgttggtatc
ttggacgtcggtggccgcgaccagtgcggtggtgactctggtggtcccctcctccataac
aatgccgttgttggtgtctgctcttggggtcacagggaatgtgctcacccaagataccca
ggtgttaatgcacttgtctcccgttacacaaattggatccaggctaacgcttaa

DBGET integrated database retrieval system