KEGG   Pieris rapae (cabbage white): 110996386Help
Entry
110996386         CDS       T05162                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap03030  DNA replication
prap03410  Base excision repair
prap03420  Nucleotide excision repair
prap03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:prap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110996386
   03410 Base excision repair
    110996386
   03420 Nucleotide excision repair
    110996386
   03430 Mismatch repair
    110996386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:prap03032]
    110996386
   03400 DNA repair and recombination proteins [BR:prap03400]
    110996386
Enzymes [BR:prap01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110996386
    6.5.1.6  DNA ligase (ATP or NAD+)
     110996386
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110996386
DNA replication proteins [BR:prap03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110996386
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110996386
DNA repair and recombination proteins [BR:prap03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110996386
   NER (nucleotide excision repair)
    Other NER factors
     110996386
   MMR (mismatch exicision repair)
    Other MMR factors
     110996386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 110996386
NCBI-ProteinID: XP_022119718
LinkDB All DBs
Position
Unknown
AA seq 850 aa AA seqDB search
MSQSSIRSFFTVTPKKPVEVKTEEQKNKSFESDTVSPPSNGKDKITKRSRSTSTEDEINS
NCASPELSEKKKPKRRRIVSSESESDSKSDQEIKLDKTRQPKTYDSPKTKKINKIKTEKL
SPVNKKSENPSAKKDSPKVKKETATSPRNKKEEIKSPPDKKKIASLFAKKTDLKVEDKEN
STVEKEKTAEVDYNPAKPKYHPIKDACWNKGQEVPYLALAKTLENIEGTSARLKMIDILS
NYLRSVMLLTPEDLLPSIYLCLNQLAPAYHSLELGMAETYIMKAIGQCTGRTLAQVKSAA
RTTGDLGLVAEQARATQRTMFPPPPLTLRKVFAALKEVAQATGQASVNKKIGKIQSLYVA
CRHSEARYLIRSLEGKLRIGLAEQSVLQAIACACAASPTAGPLAGTVDVSADMSQEKFKA
RVDEFSLIIKTTYCECPNYDSIVDVLLKYGVEALPQHCRLTPGVPLKPMLAHPSRGVADL
FTRFDGERFTCEWKYDGERAQIHVPGTESPDLTKASIFSRNQEDNTSKYPDILSRLPKLL
KESVQSCVLDCEAVAYDTANKQILPFQILSTRKRKDAQASEIKVQVCVFVFDLLYLNGSP
LVRESLERRRALLKENFNEIEGEWEFARGRDCSSPEEVEGELAEALRGSCEGLMVKALDG
DKARYDIARRSHNWLKLKKDYLEGCGDSIDAVVVGGYHGKGKRAGHYGGFLLACYDPEMD
AYQTLCKIGTGFSDEDLRTFSETLKAHVIDAPKSYYSYENSMNPDVWFEAACVWEVRCAD
LSLSPAHRAALGLVDRDKGISLRFPRFIRCRDDKRPEQATSARQVADMYLAQDQVKNTAG
NKTAQEDDFY
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatctagcattcgatctttctttactgtaactcccaaaaagccagtagaagtc
aaaacggaagaacaaaaaaataagtcttttgaaagtgatacagtctctccaccaagtaat
ggaaaagataagataacaaagagatcaagatctacaagtactgaagacgagattaatagt
aattgtgcatcaccagagttatctgaaaagaaaaaaccaaaacgcaggcgcattgttagt
tcagaaagtgagtcagattcaaaatcagaccaagaaataaaattagataaaaccaggcag
cctaaaacttatgactctcccaagacaaagaaaatcaacaaaataaaaactgaaaaatta
agtccagtaaataaaaaatcagagaatccttctgctaaaaaagacagccctaaagtcaag
aaagagactgctacgtcaccaagaaataaaaaagaagaaataaaatcacctccagataaa
aaaaagatagcatcactttttgcaaagaagactgacctcaaagtggaagataaagaaaat
agtacagttgaaaaagaaaaaactgcagaagtggattacaacccagcaaagccaaaatac
catcccattaaggatgcatgttggaacaaaggtcaagaggtcccatacttagcattagcc
aaaacattggaaaatattgaaggcacatcggctagactgaaaatgatagatattctgagc
aattacttaagatctgtgatgctgctcacacctgaggatctgctacccagcatctatttg
tgcctgaatcagttggcacccgcatatcacagtttggaacttggtatggctgagacgtat
ataatgaaagcaataggccaatgtactggtcgtacgctggcccaagtaaagagtgcagca
cgcacaactggagacctgggactagtggcggaacaggctagagccactcagcgcaccatg
ttccctccaccaccgctaacgttgaggaaggtcttcgctgccttaaaagaagttgctcaa
gccactggtcaggcatcagtaaacaaaaagataggcaaaatacaatcgctgtacgttgcc
tgccgacattctgaagcgcgatatttaatcagatctctggaaggtaagttacgtataggt
ctggctgagcaatcagtgcttcaggctatcgcttgcgcatgcgcagcgtcgcctacggcc
ggtcctctcgctggcactgtagacgtgagtgcggatatgagtcaggagaaatttaaggcg
cgcgtagatgaattctcactaataataaaaacgacatactgcgagtgccccaactacgat
tcaatagtagatgtattactcaagtatggggtggaggctttgccccaacactgtaggttg
accccaggggtcccactcaaacctatgctggcgcatccttcgagaggagtagctgatctt
tttaccagattcgatggtgagcgattcacatgcgaatggaagtatgatggcgaacgagcg
caaattcacgtccctgggacggaatcacctgacctcacaaaggcctccatctttagtagg
aatcaggaggacaatacaagtaaatacccagatatcctgagccgtttgcccaaactgctg
aaggaatcggtgcaaagttgtgtattggactgtgaggctgtcgcttatgacaccgcaaat
aaacagattttacccttccagatcctgtcaacgcgcaaacgcaaagatgcgcaggcgtcg
gaaatcaaggtccaagtgtgcgtgttcgtctttgacttgctttatctgaacggatcgcct
cttgttcgtgaatctttggagagacgtcgagctcttttgaaggaaaactttaatgaaatt
gaaggtgaatgggaattcgcccgtggtcgagattgtagtagccctgaggaagtggaagga
gagctggctgaagccttgcgaggaagctgtgagggtctcatggtgaaggcgttggatggg
gacaaggcgagatatgatatcgcccgacgttcgcataattggcttaagcttaaaaaggac
tatctagaaggttgtggagacagcatagatgcagtggtggtgggcgggtaccacgggaag
ggcaaacgagcagggcattacggcggattcctgctcgcgtgctacgatcccgaaatggat
gcttatcagacgctctgcaagatcgggaccggattttctgatgaagaccttcggacattt
agtgagacattgaaggcgcatgttattgatgcccccaaaagttattatagttatgaaaac
agtatgaacccggatgtatggtttgaggcggcgtgtgtttgggaagtgcgttgcgctgac
ttgtctctgtcgcctgcgcacagagcagctctcggcctagtggaccgggataagggcatc
tcacttaggtttcccaggttcatccgttgtcgtgacgataaacgtcccgagcaagcgacg
agtgcacgacaagtggctgatatgtatcttgcccaggatcaagtcaaaaacacagccgga
aataaaacagcgcaagaagacgacttttactaa

DBGET integrated database retrieval system