KEGG   Pieris rapae (cabbage white): 110997231Help
Entry
110997231         CDS       T05162                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
prap  Pieris rapae (cabbage white)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:prap01002]
    110997231
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prap04147]
    110997231
   04090 CD Molecules [BR:prap04090]
    110997231
Enzymes [BR:prap01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     110997231
Peptidases [BR:prap01002]
 Metallo Peptidases
  Family M2
   110997231
Exosome [BR:prap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110997231
CD molecules [BR:prap04090]
 Proteins
  110997231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 110997231
NCBI-ProteinID: XP_022120980
LinkDB All DBs
Position
Unknown
AA seq 687 aa AA seqDB search
MAVKKGALILFAFYTRFACCDYYRMGTNTNAAEAMQFLREYDREASGMCYRVTIAQWKFV
TNITEYNRRKMLEELGINSKFERLSWRKAAAYDASRVSDPQSRRQLVKILQGSRSALPDE
QFSEIQTLINEMKEIYNSAKICPFGQKPYDPHIPRLPPTEVPEINQHQYHLSNEPFQHYK
LNQEVTEFPNYCDMQLDPEISRILAHSRIESELLYVWKSFRDKTGPKLKNRFMRYVQLAN
QAAISSGYKDAGDQMRSAYDDPSFRESVEEVYNQVAPLYKQLFTYVRRKLVQRYGENSVR
SDGPIPAHLLGNMWAQNWKSIMDLVMPFPQAANIDVTSEMLRQGFTPLRIFQMSEEFYTS
MGMKPVPPEFWRGSMLVRPSQRSVQCTASAWDFCNRIDYRIKQCTEVTMQDLISTHHEMA
HIQYYLQYADQPHLFRDGANPAFHEAVANAATLSVYNLPHLQRVGLYQNKSHDPYEVTMN
FLMSMALEKVAYLPFAFMVDQWRWSVFEDGVENMNTRWWQMKLRYQGVTPPITRTEADFD
PGSKYHIISDQEYIKYFLATILEFQIFEQLCLVSGHLGHLHECDIYRSRDAGRLLSEIMQ
PGSSKSASEIIRSVTRGRTNRISPEALVKYFRPLELWLRVQNRDEQLIGWNSNQLDVALF
APRKSAGTFDSPPLFSIVITVCLWMFY
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaaaaaaggcgcgttaattttatttgctttctacacacggttcgcgtgctgt
gattattatcgaatgggcactaacacaaatgcggctgaagcgatgcaattcctgagggag
tacgacagggaagcgtcaggcatgtgttacagagtaacaatagcacaatggaagttcgtt
accaacataacagaatataatcgccgcaaaatgcttgaggagttgggaattaactccaag
tttgagaggctctcatggaggaaggcagctgcgtatgatgcctccagggtgtcagatcct
cagagcaggcggcagctggttaaaatcctccagggcagtcgatctgccctgcctgatgaa
cagttttccgagatacaaaccctaataaatgagatgaaagagatatacaattcggcaaaa
atatgtccctttggtcagaaaccatatgatcctcatatcccgaggctgcctcccacggaa
gtgccggagataaatcaacaccagtaccatcttagtaatgagccattccagcattacaaa
ttgaaccaggaggtgacagagttcccaaactactgtgatatgcaactggatcctgaaata
tccaggattctcgcccactccaggatagagagcgagttgctctacgtctggaagagtttc
cgggacaaaactggaccgaaattgaaaaatcgcttcatgagatacgtgcaactggcgaat
caggctgcaattagctctggttacaaagacgcaggtgaccagatgagatcggcctatgac
gatccctctttccgagagagtgtagaggaggtctacaaccaggtggccccactttacaag
caactcttcacttatgtcagacggaagctggtgcaaagatatggcgagaacagtgttcgc
agtgatgggcccataccggctcatttattaggcaacatgtgggcccagaactggaagtcg
ataatggacttggtgatgccgtttcctcaggctgcaaacattgatgtgacctcggaaatg
ctgcggcagggatttacaccactgagaatattccaaatgtcagaagagttctatacctct
atgggcatgaagccagtgccgccggaattctggcgcggttccatgctggtccgaccttcg
cagagaagcgtccagtgcacggctagcgcttgggacttttgtaatcggattgactataga
ataaagcaatgcacagaagtgacaatgcaggatttgatatctacacatcacgaaatggca
cacatacaatattatctacaatacgctgaccaaccacatctattcagagacggggctaat
ccggctttccacgaggcagtagcgaacgcggcgacattatcagtgtataatttgccacat
ttacaaagagtgggactttaccagaataagtctcatgatccctacgaagtgacgatgaat
ttcctcatgtccatggctttggagaaggtggcttatttacctttcgcgtttatggtggat
cagtggcgctggtcggtatttgaagatggcgtcgaaaacatgaacacaagatggtggcag
atgaaactaagatatcaaggagttacaccacctattacaaggacagaagcagattttgat
cccggatccaaatatcacattatatcagatcaagaatacataaagtactttctggcgacg
atactcgagttccagatttttgaacagctgtgccttgtctccggtcatctgggacacctg
cacgagtgtgatatatacaggagtagagatgctggaaggctgttaagtgaaataatgcag
ccaggctcctccaagtcagcgtcagagatcattcgaagtgtgacacggggaagaactaac
cggatatcacctgaagcacttgtcaaatacttccgtccactcgaactatggctacgggtt
caaaatcgcgacgagcaattaatcggctggaattcaaatcaactggatgtcgctctcttt
gcgccgcggaaaagcgcgggaacttttgacagcccgccattattctctattgttataact
gtttgtctttggatgttttattaa

DBGET integrated database retrieval system