KEGG   Pieris rapae (cabbage white): 110998501Help
Entry
110998501         CDS       T05162                                 

Definition
(RefSeq) tissue inhibitor of metalloproteases
  KO
K16866  metalloproteinase inhibitor 3
Organism
prap  Pieris rapae (cabbage white)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:prap01002]
    110998501
Peptidases and inhibitors [BR:prap01002]
 Peptidase inhibitors
  Family I35: timp family
   110998501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP NTR
Motif
Other DBs
NCBI-GeneID: 110998501
NCBI-ProteinID: XP_022122873
LinkDB All DBs
Position
Unknown
AA seq 202 aa AA seqDB search
MLTRLLTIALVAASWRTSDACSCSLEHPQTHFCNSDFVIVGRVQRLFRGKDFYDAYKVKI
RSVFKATPKATLALKSGRILTPSQDSLCGVSLQPRETYVITGRVMHLQAHVQLCSYISKW
REVTPRQRKGFRVLYRQGCTCKVHINRRSTKSPNTCVAGYDECYERHGICLHDRDRRCRW
TRAPALTRCLQKQYYNNNSTMT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctgactagactgctgacgatagcactggtggcagcgagctggcgcaccagcgacgct
tgttcgtgctcacttgaacatccacagacacacttttgtaacagtgactttgtaattgtt
ggacgagttcaaagactgtttagagggaaagatttctacgacgcttataaagtgaaaatc
cgaagcgtttttaaggcaactccaaaggcaactttagccttaaaatcaggccgaattttg
acgccatcacaggattcattatgtggtgttagcctacagcctcgagagacctatgtcatt
acgggtcgcgtgatgcacctgcaagcacacgtccagctgtgtagctacatcagcaaatgg
cgggaggtgacgcctcgacagaggaaaggcttccgtgttttgtatagacagggatgcacg
tgcaaggtgcacataaaccgacgcagtacaaagtctccaaacacatgtgtggcaggctac
gacgagtgctacgaacgacatggcatctgcttacatgatagggacaggcggtgcaggtgg
actagagccccagccctgaccaggtgtctacagaagcaatattacaacaataacagcact
atgacttga

DBGET integrated database retrieval system