KEGG   Pieris rapae (cabbage white): 110999834Help
Entry
110999834         CDS       T05162                                 

Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap03440  Homologous recombination
prap04068  FoxO signaling pathway
prap04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:prap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    110999834
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110999834
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110999834
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:prap01001]
    110999834
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:prap03032]
    110999834
   03400 DNA repair and recombination proteins [BR:prap03400]
    110999834
Enzymes [BR:prap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110999834
Protein kinases [BR:prap01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   110999834
DNA replication proteins [BR:prap03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110999834
DNA repair and recombination proteins [BR:prap03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    110999834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase TAN FATC FAT
Motif
Other DBs
NCBI-GeneID: 110999834
NCBI-ProteinID: XP_022124762
LinkDB All DBs
Position
Unknown
AA seq 2754 aa AA seqDB search
MALEQSLIEICSGLTSIRVNERKKSAESLKDMLSRSAMPSLLTENTRKKSGYTWNQVFND
IHEYILKETEKYETNKNFDNIIGTSTSLLNLCVSGSNKGGAHIKCDFIMEACLNIFNDIR
LRKAIGDAYYSVLYKHVLNNDFYVGFITPSMWENLLEACVNLCLTNSSHLDILTKFKLLW
LVIKNASNTVQFVVCLRDSLGDINKCLKKIMDDKKTQDFVMKIFILLVELLSTESRHMIC
EFTENVLPIIFKFYDHNMDVKKKSLLFKALSVAVTLHHPCGRLKNEEGSLAHDWDVWYKI
LHNVLEIVCLEINYIQKSIKQNAVSENFSLLAAITYYQIFNENKDANDGDESAAKRPKIN
LNKNKCFNDILKELRHSGPPWVDIIHFYVQQFKHTLTADDYISLIKTSEILIPNMGRDFD
NLGEMCCTVIEYYVKNPNNITYYVNVFYDLWNACVRNATTPATLKSIHMIIQSFLRLDIL
KYSHVQPLLALYFENGMPVTNCSLITLALVYSKFYSNCCYSDQRVKCVEWLKQMSITDIN
VNYLGNILFRLISNENMVMRFDITSDVPKLHEVLNNMETSILFSNFEYEVEKKEIKSTKE
DLVAVEFNQEMLTLILDYFLRKVTELSSKPHSTETLIETVKYIHLILKLYESLQKYKIIS
KEFTVNSELYFITVDTLKKLFIHLTRSLRSDEPVRKKIKFTKCLQELLQDNFGCFLNGVA
RSCIDVNCFHAVNEILKTEVELDDDEDIEIGPVGLKCQCLYFLVAYCYYSHTYTDELVKC
ILDEDLYKFDAQWDVDCALKCIEMVIDHDEDDKYLDSVFGLMKNMCRVLFRNSTASVGLL
QLLLKILDRIWLHNDSVMRKNCIIMVKGYYERCNKLYYTPRLASIIYECVARVINLNRRY
RFELEFDTNLIKQIKGNSHSIRIYCCYLLKYVYENLDVDDVKEVSNSLLDIFVITVPSEN
EIVLKDETINRTLTVLHCFCALSKIRHWLLHTIVFQIIHTQKQKSLNKSLTRKALSLIVK
DIAERNFDEYVNNNILDILYSWFIEGEKFDSIPLNLLGFKLDVFLEKHAKWLVAAEVLWS
CKGHIERSETVKLVAAKTKKTVEEVIEMCFCAVITLCLPYIVVEKYEMHSEKHADFKALF
ENSNRMFHSTRQILDNEKWSNLFVEHLGDLILLAATHVCDPQSAKEQFKLEEMHMKNRFL
CSKAVFKGVLRYFGELIDGDVIEYFLGNQPLVILNILFKLWGNFVNENVADFKILQLHTY
VCFIENIKIGFPCDAVLFNFILNSLANAINTSVTNQLKAIVGVLKQILDKLKQANRLQSL
RENISAKILAILSAKDANLMELNEIDVVDSVVYKSNVSQHKCATKLEFTNMLETYTTSLI
YPSNEILCNLREFLKTNADHVNDLCKELNIKGFSEDCSNSLVHCIINGLSNILKTSNEDK
IVIEACNCLAEMATYDIKTLVTVPPADTERLESLSAKEYFTYKTLETLSSELFDKDPSVN
SKVAVVINRVLKYRDGKLALDMEGINKEILQPLSPLNSDIHAEYQIDDRKFESFNSPDFW
VPKPSEDHLNWVVRITTSLLSLIAAGNNCAGVLSAVCALKPTLSAKVMPSILGLLFDCDA
RSKSEKLIKSLGEQLNQFFTYIWKLTFDDKLENSEDGTCAGVSSKLDHNHKMIIQYILQV
IDFIRLQAKNYRIKKSLPLNYLNLDYKKVAWASALADLNLVAIYYGELWAAAQNGGVPPS
SPDATSNLDGGSHLQRIFRGCFVSIGEPDAVEGCGTAHLTSEDEKRKHLINTGQFTDSLL
LHDIALSGSHDQTLQYGAVTSLHKAGMHHLALQYIKSCPESELFNDIKYDCLSLLGDWSD
FVDTRELEQKSKLTFNTNSITKKFRYACLKDCLNIQTSEDFHTKLEQPLNGAKLAISRLC
RRLNMENSQCVYKIMACLHLFRDIESYFAVRCGKFHIKVLLDMWKIDKLPPYKDFKHLES
LISQRGLILQHAAENNGLYSEKINSLQLQYAELGLSNQRVQIAQRIVAMVKRFQPSKEVT
LLESKVLWDKGHKDIALSLLHDNIVDETDNVKLTAMSLRQYGLWMAECKRENARDIINQY
LEKSLEVLKDFDDLETRNKVYYDIAQFADAEYKLVVTYMNSSTFENKVKCMESMKGTAAS
LRSTQQTLTRDEKKALIANNAFRQMDEAEIANTRAEKETFLELAMRFYLLSLKQSDDNNL
SIFRVISLWFENNLVNLSGLGEALKAVPSWKFITVLPQIAPRLSADDTSFVHLKEILVRC
AKEHPHHTLPTLFNLKNSDKDKNYGKNQSQLFRSPPEPRVIAAGELISGLEKMDPKTAIL
IKQMDTLYDAIISFAYFTSPFKDIGKQFSLPKEEAISRLRDLNSIPVPTDTIAIKRNCDY
SDLSSFSGFDNYFEMVGGINYPKKVNCRSSDGKKRILLIKGEDDMRQDAVMQQVFSIVNT
LLEKNPITYHNKLLIRTYKVVALSRRSGVLEWCAGTVPLGTYLTHAHVRHRPQDISPTIA
RGKIKESQEKKLSNKQKLAVFNEILRVFKPVFHYFFTEHYLDPVTWYERRLAYTRSVATS
SMVGYILGLGDRHVQNILIDKTTAEVIHIDFGIAFDQGKTLLTPETVPFRLTQDIIAGFG
CSGVEGIFRRCCEKTLQLLRDNQETLLTILEVLLCDPLYLWIVPNTPKNPNESRAETASG
GLAERALLAVRSKLNGAESGAGGVSVRGQVAALLHRATDRANLCRLFHGWQPYL
NT seq 8265 nt NT seq  +upstreamnt  +downstreamnt
atggctttggagcaatcgttgatagaaatatgttcgggtctcacctcgatacgtgttaac
gagagaaagaaaagtgctgaatctttaaaagatatgctcagtagatctgctatgcctagt
ttacttacagaaaatactcgcaaaaagtcaggttacacttggaatcaagtttttaatgat
atacatgaatatatactcaaagaaactgaaaaatatgaaacaaataagaattttgataat
attattgggacttcaactagtcttctgaatttatgtgtatcggggtcaaataaaggtggt
gctcatataaaatgtgattttattatggaagcttgtttaaatatatttaatgatattcgt
ttaagaaaagctattggagatgcatattatagtgtcctttataaacatgtcttgaacaat
gatttttatgtagggttcattactccatcaatgtgggaaaatttacttgaagcttgtgtg
aacctctgtttaactaattcatcacacttggatattttaacaaagttcaaattactatgg
ctggttattaaaaatgctagcaacactgttcaatttgttgtatgccttagagattcatta
ggagatataaataaatgtttaaaaaaaataatggatgacaaaaagacacaggactttgtt
atgaagattttcatactattggtggaattgctgtccacagaatctcgtcatatgatctgc
gagttcactgaaaatgtacttcctataatatttaaattttatgaccacaatatggatgtt
aagaaaaagtctttattattcaaggcattaagcgtcgcagtgacacttcaccacccatgt
ggcagattaaaaaatgaggagggtagtttagcacatgactgggacgtttggtataaaatt
ttacataatgtgctagaaatagtttgtctcgaaattaattacatacaaaaatctataaaa
caaaatgctgttagtgagaatttttcactcttggccgccattacatattaccaaatcttc
aatgagaataaagatgcgaatgatggagacgaatcagcggcaaagagaccgaaaataaat
ttaaataagaacaaatgttttaatgacatattaaaggaattacgacatagtggaccgcct
tgggttgatattatacacttctacgtgcagcagttcaaacacactctaacagctgatgat
tatatttccctcattaaaacctcggagatactaataccaaatatgggcagagattttgac
aatttgggcgaaatgtgttgcactgtcatagagtattatgttaaaaatccgaataatatt
acctactatgttaatgtgttttatgatctatggaatgcctgtgttagaaacgcaacaaca
ccagcaactctaaaatccattcatatgatcattcagtctttcctaagattagacatatta
aaatattctcatgtccaaccacttttagctctatattttgaaaatggaatgcccgtcacc
aactgttcccttataacattagccctcgtttattcaaaattctattccaactgttgttat
tctgatcaaagagttaaatgcgtggagtggttaaaacaaatgagcatcaccgatattaat
gttaattacttaggaaatatcttattccgtctcatttctaatgagaatatggtaatgagg
tttgatattacgtccgatgtacctaaacttcacgaggtgttgaataatatggaaactagt
attctattttcaaattttgaatatgaagtcgaaaaaaaagaaattaaaagcacaaaggag
gatttagttgccgtggaatttaatcaagagatgttaacactaatattagattattttctt
cgtaaagtgactgagctgtcttcaaagccccactctacagaaacattaatagaaactgta
aaatacatacatctgatactaaaactgtatgagtcgttgcaaaagtacaagataatttca
aaggaatttacagtcaactccgagttatacttcataacagtagacacattgaaaaaactg
ttcatacatttaactcgttcactgcgttcagatgaaccagtgagaaagaagattaaattc
accaagtgcctccaagagttgttgcaagataattttggttgttttctcaacggtgttgcc
agatcgtgtatagatgtgaactgctttcatgccgtcaatgaaattttaaagacggaggtg
gaattggatgatgacgaggatatagagatagggccggtgggattaaaatgccagtgctta
tattttttagtcgcgtactgctattattcccatacgtatactgacgagttggtcaaatgc
atactggacgaagacttgtataaatttgacgcacaatgggatgtagattgtgctctcaaa
tgtattgaaatggtcatagatcatgatgaggatgataaatatctggactctgtgtttggg
cttatgaagaacatgtgtagagttttgtttagaaattctacagcgagcgttggtcttttg
caattattactcaagattttagacagaatatggcttcacaacgacagtgtgatgagaaag
aactgtataataatggttaagggttactacgaacgatgtaataagttgtactatactccc
cgtcttgcttcaataatatacgaatgtgtcgcccgagttatcaaccttaatagacgatat
agatttgaactagagtttgatacgaatcttattaagcagataaaaggaaatagccacagt
ataaggatatattgctgctatcttctgaaatatgtttacgagaatttggatgtggatgac
gtcaaggaagtttccaattctcttctggatatctttgttataactgtgccgtcggaaaat
gaaatagtattaaaagatgaaacaataaatcgtacactaacagtgttgcattgcttttgt
gccttatccaaaatccggcattggttactccatacaattgtattccaaataattcacacc
caaaagcaaaaatccttgaataagagtctcacgagaaaagctttgagtctcattgtaaag
gacatcgctgagcggaacttcgatgaatatgtgaacaacaatattttggatatactttat
tcttggtttattgaaggcgagaaatttgatagtatccctttgaatctattgggttttaag
ttggatgtatttctggagaagcacgcgaaatggctggtggctgcggaagtgctgtggagt
tgtaagggtcacattgagaggagcgaaactgtgaaattggttgctgcaaagactaagaag
acagtcgaggaagtaatcgagatgtgtttctgtgctgtcataacgttatgcctaccctac
attgtagtggagaaatacgaaatgcatagcgagaaacacgccgatttcaaagcgttattc
gaaaattcgaatagaatgttccattcgacaagacaaatattagataatgagaaatggagc
aatctcttcgttgagcatttgggtgatcttattctgttggctgcgactcatgtgtgtgac
cctcagagcgcgaaagaacagttcaaattagaagaaatgcatatgaagaatagatttttg
tgttctaaggctgttttcaagggagttttgcggtattttggggagctaatcgacggtgat
gtcatagagtattttttaggaaaccagcctttagtcatccttaacatactctttaaactc
tggggtaactttgtcaatgagaatgtagcagatttcaaaattctacaactccatacatac
gtttgctttattgaaaacattaagattggttttccgtgcgatgctgttttgtttaatttt
attcttaacagtctcgctaatgcaataaacacgtcagtaacgaatcaattgaaagccata
gtcggagtattaaagcagattttggataagcttaaacaagcgaatcggttacaatcgttg
cgggaaaatatttccgctaaaattctagcaattttgagcgctaaagatgcaaatttgatg
gaattaaatgaaatagatgtagttgatagtgttgtttataaaagcaatgttagtcaacac
aaatgtgctactaaactggagtttacgaatatgttagaaacgtatacaactagtttaata
tacccaagcaacgaaatactgtgcaaccttcgggaatttctaaaaacaaatgcagatcac
gtaaatgatctctgtaaggagttaaatattaaaggattttcagaggattgctcgaatagt
ctggtccactgtattataaatgggctaagtaatattttgaagacttcgaacgaggacaag
atagtaatagaagcctgcaattgcttagccgaaatggctacttacgatataaaaacactt
gtcacagtgccgccagcggatacagagcggttagaatcattatcagcaaaggaatatttt
acatacaaaacattagaaacactgtctagcgaactctttgataaagatccgtcagtgaat
agcaaagtcgcagtcgttataaaccgggttctgaaatatcgcgacggaaagttggcttta
gatatggagggaattaacaaggaaatattacaaccgctgtctcccctaaatagcgatata
cacgcagagtatcagatagatgacagaaaattcgagtcgttcaattctcctgatttctgg
gtcccaaagccaagcgaggatcacctgaattgggtcgttaggataacgacaagtctgtta
tcgttaatcgccgcagggaataattgtgctggtgtccttagcgcggtttgtgctttaaag
ccaacattatcagccaaagtgatgccatccatcttgggcctcctatttgattgcgatgcg
cgttcaaaatctgaaaaactcataaaatccctgggagaacagttaaatcaattcttcact
tacatttggaagcttacttttgatgataaattggagaactcagaagatggaacctgcgca
ggagtgtcaagtaaactcgaccacaaccacaaaatgattattcagtacatacttcaagtt
attgattttatccggctgcaagcgaaaaattatcggatcaaaaagtccttaccgctgaac
tacctaaacttggactataagaaggtggcctgggcaagcgctttagcagatttgaacctc
gtagctatatactatggggagttgtgggctgcggcacaaaatggtggtgttcctccctcc
tcaccagatgccacttccaacttggatggtggttcacatctacaacggatttttagagga
tgcttcgtatcaatcggcgaacctgacgctgtggagggctgtggaacagcccacttgaca
agtgaagatgagaaacgaaagcatttgataaacacaggccaattcacggattccctccta
ttgcatgacattgcactatcgggttcgcacgaccaaaccctgcaatatggagcggttaca
tcgcttcataaggctgggatgcaccatttagccttacagtatatcaagtcatgccctgaa
agtgaattattcaatgatatcaagtatgactgcttgtcgcttctcggtgactggagtgac
tttgtcgatacaagggaattggaacaaaagtccaaattgacgtttaacacaaattctata
accaaaaagtttcgatatgcatgtctcaaagactgcctaaatatccaaacgagtgaagat
ttccatacaaaacttgaacagcctctaaatggagctaaacttgccatttcgcgattgtgt
aggaggttgaatatggagaattcacagtgcgtttacaagattatggcgtgccttcatcta
tttcgggatatagagagttattttgcagtgagatgtggcaagtttcatatcaaggtgttg
cttgatatgtggaaaattgataaattgccgccgtacaaggactttaagcatttggaaagt
ctgatatcgcaacggggtttaatacttcaacacgcggccgagaacaatggcctttattcg
gagaagattaattctctgcagttgcaatatgccgaactgggcttgtcaaatcaaagagta
caaattgcacagcgcattgtagcgatggtaaaacggtttcagccatcgaaggaagtgact
cttttagagagtaaagttttgtgggataaaggacacaaggacatcgctctgtccttatta
cacgataacattgtcgatgagacagataatgtcaagttaactgctatgtcgttaagacaa
tatggcttatggatggctgagtgtaagcgagaaaatgcaagagatataatcaatcagtac
ttagaaaaaagccttgaagtactcaaagatttcgacgatttggagacgagaaacaaagtg
tactatgatatagcacagttcgccgatgccgagtacaaacttgtggtgacatacatgaat
tcgtctacttttgagaacaaagtcaaatgtatggagagtatgaagggaaccgccgctagt
ttgagatctactcaacaaacgctcacgagagacgagaagaaagcgttaatagcgaacaac
gcatttcggcaaatggacgaagctgagattgcgaacacgagagcggagaaagaaacattt
ttggaactagcaatgagattctatttattatcacttaaacagagtgacgataataacctc
tcaatatttcgagttatatcactgtggtttgagaacaatttagtgaatttgagcggttta
ggcgaagcccttaaagcggttccatcatggaaattcataactgtgttaccacagatcgca
ccacgcctttccgctgatgacacgtcctttgttcacctaaaagaaatattagtgcgctgt
gcaaaagagcacccgcatcatacattacccaccctcttcaatctaaagaattcagacaag
gacaaaaactatggaaagaatcaatctcagttatttcgaagcccgccagagccaagggtc
atagctgctggagaattaatatcaggattggagaagatggatcctaaaacggcgatttta
ataaaacaaatggatacattatatgatgctataataagcttcgcatacttcacatctcct
ttcaaggatataggcaaacaattttcattaccaaaggaagaggctatttctcgtctccgt
gacttgaatagtattcccgtaccgacagatacgattgcaattaaacggaattgtgattac
tccgatttgagtagtttttctggttttgacaactatttcgaaatggtgggtggaataaat
taccccaagaaagtgaattgtcgaagttcggatgggaagaaacgaattctattaattaag
ggcgaagatgatatgcgacaagacgcggtgatgcaacaagtgttttcgatcgtcaataca
ctacttgaaaagaatccaattacatatcataataaattactcattcgcacctataaggta
gttgcgttgtcccgtcgttctggtgtgttggagtggtgtgcgggcactgtgcccctcggt
acgtacttgacgcacgcgcacgtacgtcaccgcccacaggatatctcaccgactatcgct
agaggcaagataaaagagtcccaagaaaagaaactctcaaacaaacagaagttggcggtt
tttaacgaaatattgcgagtgtttaaaccagtttttcactatttctttactgaacattat
cttgaccctgttacttggtacgaacgaaggctcgcatataccagaagtgtggcaacatcg
tcaatggtcggatacatacttggtttaggtgatcgtcatgtgcaaaacatattaattgat
aaaacaactgctgaagttattcatatagatttcgggattgccttcgaccaaggcaaaact
ttactcactccggagacagtacctttccgcttgactcaagacatcatcgctggctttggt
tgtagcggtgttgaaggaatatttcgaagatgctgtgagaaaacactacaattgctccga
gataaccaggagacattgctgacgatactggaagttctattatgtgatcccttatatctt
tggattgtgcccaatactcctaaaaatcccaacgagtcacgtgctgagacagcgtcagga
ggactagcagagcgggccttgttggccgttcgtagtaagttaaatggagcggagagcgga
gcgggcggcgtttcggtacgagggcaggtcgccgcgcttctgcatcgtgccacagaccgg
gctaatctctgcaggctgtttcatggatggcaaccctatctgtga

DBGET integrated database retrieval system