KEGG   Pieris rapae (cabbage white): 110999837
Entry
110999837         CDS       T05162                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog A-like isoform X1
  KO
K20017  Bcl-2 family protein
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04214  Apoptosis - fly
prap04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:prap00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110999837
   04215 Apoptosis - multiple species
    110999837
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110999837
NCBI-ProteinID: XP_022124765
LinkDB
Position
Unknown
AA seq 242 aa
MVSSTAAAAVSRRLSATIGWCLAMPTQVKPQIVRQGRALCLQYIKTQIRRSSTCPKKQIV
LKRLQQMLETECGEEAINNVESGVLAALRALCAALERKRPDAFRHVARQATRAPSAMLRS
DTALAELALALARRITRENITWSKIAAVYCICGALAREAAEAADSEPALELIAAPAAAIA
DLLHEEPGNWVASHGGWNGLIERLRVSERDQRSEKNLRVMISIFVIACATLFFLRVLSIL
TQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atggtatcaagcacggcagctgctgcagtctcccgaaggttgtctgccaccattggttgg
tgcctagccatgcctacccaggtcaaaccgcaaattgttcgacaaggaagagctctatgt
cttcagtacattaagactcaaatacgcagatcttcaacatgccctaagaagcaaatagta
ttaaaacgcctacaacaaatgctggaaacggaatgcggagaagaggcaataaacaatgta
gagtcgggagtactagcggcgttacgagctttatgtgcagcgttagaaaggaaaaggcct
gacgcatttcgacacgtagcccgtcaggcgacaagagctccctcagccatgctccgttcc
gacactgcccttgcggaacttgctttagccctagctagacgcattactagagaaaacata
acttggtcaaagattgcagctgtatattgcatatgtggtgcattagcaagagaagctgct
gaggcagcagacagtgaacctgctctagaacttatagcagccccggcagcggctatcgca
gatctcctgcatgaagaacctggcaactgggttgctagtcatggcggttggaatggactt
attgagcggctgcgcgtcagtgaacgtgaccaaagatctgaaaaaaatttacgtgtaatg
atctccatcttcgtgattgcctgcgcaacgctattttttcttcgcgttttatctattctt
acgcagtga

DBGET integrated database retrieval system