KEGG   Pieris rapae (cabbage white): 111000336Help
Entry
111000336         CDS       T05162                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00020  Citrate cycle (TCA cycle)
prap00190  Oxidative phosphorylation
prap01100  Metabolic pathways
prap01200  Carbon metabolism
Module
prap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prap_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111000336
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111000336
Enzymes [BR:prap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111000336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Selenoprotein_S
Motif
Other DBs
NCBI-GeneID: 111000336
NCBI-ProteinID: XP_022125426
LinkDB All DBs
Position
Unknown
AA seq 656 aa AA seqDB search
MSTLLKAALSRSPASLATHLYRNLHLSVGGASPLKEASANSNVAQSYTVIDHKHDALVIG
AGGAGLRAAFGLVQEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEEDNWLWHMYDTVK
GSDWLGDQDAIHYMTKEAPHAVIELDNYGMPFSRTPEGRIYQRAFGGQSLKFGKGGQAHR
CCAVADRTGHSLLHTLYGQSLRYDCEYFIEYFALDLLMEDGVCKGCIALNLEDGTLHRFQ
AKNTILATGGTGRSYFSCTSAHTCTGDGTAMAARAGLQNEDMEFVQFHPTGIYGAGCLMT
EGCRGEGGFLVNAKGERFMERYAPVAKDLASRDVVSRAMTVEIMEGRGCGPEKDHVHLQL
HHLPPDQLKQRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGTPTNFRGEVITHHNGQ
DRVVPGLLAAGEASCASVHGANRLGANSLLDIVVFGRACAITVAETSRPGDVQAPLKDTT
GQESITNLDQIRYANGTIPTAALRLRMQKNMQTNAAVFRQKNTLEEGQRQIHEIYKQIGD
VKISDRSLIWNSDLVETLELQNLLINSVQIVEGALAREESRGAHAREDFKTRRDEYDYSK
PLDGQTKLPFEKHWRKHTIAETNASTGETHLTYRPVIDKTLDQQECKTVPPVIRTY
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagtacattattgaaagcagctttatctcgtagcccagcgtcactggctacgcatttg
taccgaaatctccatttatctgttggcggagcatcacccctgaaggaggcttcagccaat
tccaatgtcgcacagtcgtacacagtaattgaccacaaacacgatgcactcgttattggt
gcgggaggcgcgggcctacgagcggcttttggtcttgtccaagaagggttcaagactgct
gtggttacaaaactttttcccacaagatcacatacagttgctgcacagggtggaataaat
gctgcactgggtaacatggaagaagataattggctctggcatatgtatgacaccgttaag
ggttctgattggcttggagaccaggatgccatccactacatgactaaagaagcacctcat
gcagttattgaattagacaattatggtatgcctttttcacgaacaccagaaggccggatt
taccagagagcctttggtggccagtccttgaaatttggaaagggtggtcaagcacataga
tgctgtgctgttgcagacagaactggacactctcttttacacacattgtacgggcagtct
ctccgatatgactgcgaatactttattgaatattttgcattggaccttctcatggaagac
ggagtttgtaaaggttgcattgcattgaaccttgaagacggaacacttcacagattccaa
gcgaagaacacaattttagctacaggcggtactgggcggtcttacttcagttgcacatca
gctcacacctgtaccggagatggaacagctatggctgctcgagcaggattacagaatgag
gatatggagtttgtgcagtttcatccaactggaatctacggtgccggttgtctgatgact
gaaggttgtcgtggagaaggtggtttcctcgttaacgctaaaggtgaacgcttcatggaa
agatacgcgcccgtcgctaaagatttggcaagtcgagatgtcgtctcgagagctatgact
gtagaaatcatggaaggccgtggttgtggcccagaaaaagaccacgtgcacttacaactt
caccatttgcccccggatcagctgaagcaaaggctccctggtatttctgagaccgctatg
atcttcgctggagtcgatgtgaccaaggaacccattcctgtgttgccgaccgtacattac
aacatgggaggaacacccaccaatttccgaggagaggtaataactcaccacaatggtcaa
gatcgcgttgtacccggtctcctagcggctggtgaggcgtcttgtgcttccgtgcatggt
gctaacaggcttggagctaactccttgttagatatcgttgtattcggccgcgcatgcgca
atcactgtagctgaaacaagccgaccgggagatgtgcaggcaccgctaaaggatacaaca
ggccaggaaagcatcacgaatttggaccagataagatatgcgaacggtactatcccaaca
gccgctctgcgtctgcgcatgcagaagaacatgcaaacgaatgccgctgtattcagacag
aagaacacgctcgaagaaggccaacgtcaaatccacgaaatctacaaacaaataggtgat
gtgaaaatatcagatcgatctctgatatggaacagtgatctggtggaaaccctggaactg
cagaacttgctcatcaactcggttcagatcgttgaaggtgccttggcgagggaggaatcc
aggggtgcccatgcgagggaagattttaagacaagacgtgatgaatatgattactccaag
ccattggacggacagactaagttgcccttcgagaagcattggaggaagcacaccatagcg
gagacaaacgcatcaacaggcgagacccacctcacgtacagacctgtcatcgacaaaacc
ctggaccagcaggaatgcaagaccgtaccacctgtcatcaggacatactag

DBGET integrated database retrieval system