KEGG   Pieris rapae (cabbage white): 111003029Help
Entry
111003029         CDS       T05162                                 

Definition
(RefSeq) histone deacetylase Rpd3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04213  Longevity regulating pathway - multiple species
prap04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:prap00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111003029
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111003029
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:prap03036]
    111003029
Enzymes [BR:prap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     111003029
Chromosome and associated proteins [BR:prap03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     111003029
   HDAC complexes
    Sin3A-HDAC complex
     111003029
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111003029
  Chromatin remodeling factors
   NuRD complex
    111003029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 111003029
NCBI-ProteinID: XP_022129068
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MAMQPHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAT
ADEMTKFHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAA
AVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDESYESI
FVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGRCVELVKRFGLPFLLVGG
GGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLD
KIKNRLFENLRMLPHAPGVQVQAIPEDAVNDESDDEDKIDKDERLPQSEKDKRITGDGEL
SDSEDEGEGGRRDNRSYRVPQRKRPRLDKDNAKDDIKTEDNKEDVKNINMEEPKKELPPN
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcaaccgcatagtaaaaaaagagtgtgctattattacgatagtgatatcgga
aattattattatggccaaggacatcccatgaagcctcacagaatacgtatgacacataat
cttcttttaaactatggattatatagaaaaatggagatatataggccacataaagcaact
gctgatgaaatgactaaattccactcggatgactacatacgtttccttcgctccatcaga
ccagacaacatgtcagagtacaataagcagatgcaaagatttaatgttggtgaagattgt
ccagtgtttgatggtctatatgagttctgtcagctctctgcgggagggtctgttgctgcc
gccgtcaagttgaataaacaggcatctgaaatttgtatcaattggggtggagggctgcat
cacgcgaaaaaatctgaagcatctggtttttgctatgtcaatgatattgttctcggcatt
ttggagctgctcaagtaccaccagcgcgtactttacattgacatagacgtccaccatgga
gatggggtggaagaagcgttctacactactgacagagtcatgacggtgtccttccacaag
tatggagaatattttccgggcactggggatctacgtgatatcggagctggtaagggcaag
tactacgcagtgaatatcccacttcgggacggaatggacgacgaatcgtacgagtctatt
ttcgttcccattatttccaaagtcatggagaccttccaacccagtgcagtagtattgcag
tgtggagccgattcacttactggtgacagattgggatgcttcaacctaacagtgcgcggc
catggcagatgcgttgagcttgtgaagagatttggtcttccattcctacttgtgggtgga
ggaggttatacaatccgtaacgtatcacgttgttggacatacgagacttcggtggcgttg
ggcgttgagatagcaaacgagttgccatacaacgattactttgaatactttggaccggac
ttcaagttacacatctcgcccagcaatatgtccaatcaaaacacaactgaatatctcgac
aaaatcaagaatagactgtttgagaatctccgtatgttaccgcatgcgcctggagttcag
gtgcaagcaatcccagaagacgccgtcaacgacgaatcagatgacgaagataaaattgat
aaagatgaacgtctgccacagagtgaaaaggacaagcgaataacaggagatggagaatta
tcagattctgaagatgaaggcgaaggtggaagaagagacaaccgttcttatcgcgtacct
cagaggaagagaccgcgactcgacaaagataacgctaaggatgatatcaaaacggaagac
aacaaagaagacgtcaaaaacataaatatggaagaaccaaagaaagagttgccgcccaac
gcttga

DBGET integrated database retrieval system