KEGG   Pieris rapae (cabbage white): 111003301Help
Entry
111003301         CDS       T05162                                 

Definition
(RefSeq) vitellin-degrading protease-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:prap00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111003301
Enzymes [BR:prap01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     111003301
Peptidases [BR:prap01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111003301
Exosome [BR:prap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111003301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 111003301
NCBI-ProteinID: XP_022129423
LinkDB All DBs
Position
Unknown
AA seq 259 aa AA seqDB search
MFLLIGVVLLAGYSVSTPAQDTRIVGGEDVDITDVPYQVSLTFRGRHTCGGAIVANDLVV
TAAHCLIGSLPRDLQIRAGSSSSRTGGELYQVGDYVYHSNFTYSKMDCDLGLVWLTNPID
FSERAKPIDLYEQGEEVGDGEETIITGWGALREGGGAPKTLQIVAVPKVSDAVCSYAYSP
LYQITKSMLCAGIPDGGKDACQGDSGGPLVHNAKLAGVVSWGLGCARPKYPGVYAKVSAL
RTWLDDQANYLRLKHIFRT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgttaattggagtggtactcttggctggatactcagtatcaaccccggcacaa
gatacgcgtatagtgggtggtgaggatgttgacataacagatgttccctaccaggtgtct
ttgacgtttcgtggcagacacacctgtggtggtgcaattgtcgccaatgacttggttgtc
acagctgcccactgtcttattggctcactaccaagagacctccaaatacgagccggttcg
tcatcaagtagaacagggggtgaattataccaagttggagattatgtgtaccactcaaac
ttcacgtatagcaaaatggactgcgatttaggcctcgtatggttaacgaatcctatagac
ttcagtgaaagagccaaacccatagacttgtatgagcagggagaggaagttggtgatggt
gaagaaactatcatcactgggtggggagctttacgggaaggaggaggtgctccaaaaaca
ttgcaaattgtggcagtaccgaaagtgagcgacgctgtatgcagctatgcctactcacct
ctctatcaaataactaaatctatgctctgtgcgggcattcccgatggaggaaaggatgcg
tgtcagggagatagcggtggtccgttagtccataatgcaaagttggctggagttgtatct
tggggccttggatgtgcaagacccaagtatcctggagtatacgccaaggtgtcggctcta
agaacctggctggatgaccaagcaaactatttgagactgaaacatatatttagaacgtga

DBGET integrated database retrieval system