KEGG   Pieris rapae (cabbage white): 111003328Help
Entry
111003328         CDS       T05162                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00020  Citrate cycle (TCA cycle)
prap00190  Oxidative phosphorylation
prap01100  Metabolic pathways
prap01200  Carbon metabolism
Module
prap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prap_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111003328
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111003328
Enzymes [BR:prap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111003328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 111003328
NCBI-ProteinID: XP_022129462
LinkDB All DBs
Position
Unknown
AA seq 622 aa AA seqDB search
MDFNPSPTENIEQSFTVHHHKYDCLVIGAGGAGLRASIGLAESKFSVALVTKMFPTRSHT
IAAQGGMNASIGSMHQDDWRWHFYDTVKGSDWLGDQDSIQQLTRDAPNCIFELENMGMPF
SRTQDGKIYQRSFGGGTKNCGKEIAKRTCAVADRTGHALLHTLYGYSTKFKNIKLFSEFF
VLDLLMQDGAVVGALAMDMDDSSLHRFQAKNTVIATGGYPRMYFSCTAAHTCTGDGCSMM
TRLGFPLQDMEFIQFHPTGMYGSGCLMTEGCRGEGGYLVNSEGKRFMEKYAPKAKDLASR
DVVSRSMATEIRQGRGVGPKKDHIYLQLHHLSPEVIMKQLPGIHETAYTFTGVDVLKDPV
PVIPTVHYTMGGIAINYKGEAIINKGSGDEAIPGLHAAGEAVSNCHGANRLGANSILDVV
VFGKAIGLNIACISTPGDKQPELKHNICDAAIDNLEKVKALKGSIYPHDLRLNMRTTMQN
KCGVFREAKLLDEAQTEIQKWYAAYKDLKITDQKKNYNTDLIESLELQNMLQAAVQVVAC
ARNRTESRGAHFRDDFPKREDEMDYSKPTEGQTAKPIEKHWRKHSMSNLDLATGKVTISY
RPVIDKTLDDEVQTIPPVPRVY
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggattttaatcctagtccaacggaaaacattgaacaaagcttcacagtgcaccaccac
aagtacgactgccttgttataggagccggtggagcgggcttaagggcatctataggctta
gctgaatcgaaatttagtgtggctcttgttacgaaaatgttcccaacccgctcacacact
atcgcagctcagggtggcatgaatgcatctataggaagtatgcaccaagacgactggcgg
tggcacttttatgatacagttaagggatctgactggcttggagatcaggactcaattcag
caactaacacgcgatgcgcctaactgtatttttgaactggagaacatgggcatgccgttc
tcaaggactcaagatgggaagatctatcagcggtcgtttggtggaggcaccaagaactgt
ggtaaggagattgcgaagcggacttgcgctgttgctgaccgcacgggccacgccttactc
catacgctctatggatatagcacaaagtttaagaacatcaagttgttcagcgaattcttt
gttttggatctgcttatgcaagatggagcagtcgttggggcccttgcgatggacatggat
gacagtagtctacatcggtttcaagctaaaaacacagtgatcgctaccggtggatatcca
aggatgtatttctcgtgcacggctgcacacacatgcacgggggatggttgctcgatgatg
accagacttggatttcctctccaagacatggagttcatacagtttcacccaacaggcatg
tacggttccgggtgcttaatgacggaagggtgtcgaggcgagggtggatatctcgtgaac
agtgagggtaaacgttttatggagaaatatgcaccaaaagctaaggatttagcaagccgt
gatgttgtatctagatctatggctaccgaaattagacaaggccgaggagttggaccaaag
aaggaccatatttacctccagttgcatcatttaagccctgaagtgattatgaaacagttg
cctggtattcacgaaactgcttacacatttactggagtggatgtgttgaaggatccagtt
ccagtcatacccacagtgcattatactatgggtggcatcgccataaattataaaggcgag
gcaatcatcaacaagggtagcggtgatgaagcgataccagggttacatgcagcaggtgaa
gcggttagcaactgtcatggcgccaacagactaggagccaactcgattctcgacgtcgtg
gtgtttgggaaagcgattggcctaaatatcgcatgcatttctactcctggtgataaacag
ccagagctaaagcataatatatgtgatgcagccattgataacttagaaaaagtaaaggct
ttgaagggctcaatctacccgcacgatcttcgtttgaatatgaggactactatgcaaaat
aaatgcggtgtatttagagaagcgaagttattggatgaagcccagacagaaatacaaaag
tggtatgcggcttacaaagatttgaaaattactgaccagaagaaaaactacaacacagat
ttaatagaaagcctggagcttcagaatatgttgcaggctgcagttcaggttgttgcctgc
gctagaaaccgaacagaaagcagaggtgcacactttcgagatgactttccaaagagagaa
gatgaaatggactacagtaaaccgacagaaggacagactgcgaagcccatagagaagcat
tggcgtaaacacagcatgtcaaacctcgatctcgcgaccggaaaagtaactattagctat
agaccagtcatagacaaaaccttggatgatgaagttcagacgattccccctgtacccaga
gtttactag

DBGET integrated database retrieval system