KEGG   Pieris rapae (cabbage white): 111004100Help
Entry
111004100         CDS       T05162                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00010  Glycolysis / Gluconeogenesis
prap00030  Pentose phosphate pathway
prap00051  Fructose and mannose metabolism
prap00052  Galactose metabolism
prap01100  Metabolic pathways
prap01200  Carbon metabolism
prap01230  Biosynthesis of amino acids
prap03018  RNA degradation
Module
prap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111004100
   00030 Pentose phosphate pathway
    111004100
   00051 Fructose and mannose metabolism
    111004100
   00052 Galactose metabolism
    111004100
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111004100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:prap01009]
    111004100
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:prap03019]
    111004100
Enzymes [BR:prap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111004100
Protein phosphatases and associated proteins [BR:prap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111004100
Messenger RNA biogenesis [BR:prap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111004100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111004100
NCBI-ProteinID: XP_022130641
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MDSTKTQRFIERGSHKGKGLAVFTSGGDSQGMNAAVRSVVRMGIYLGCKVYFIREGYQGM
VDGGDNIEEANWSSVSSIIHKGGTIIGSARCMDFVQKEGRLKAACNLVTRGITNLVVIGG
DGSLTGANLFRQEWSELLDELLANNRITKDQREKYKYLHIAGLVGSIDNDFCGTDMTIGT
DSALHRIIEAIDAIVSTAYSHQRTFIMEVMGRHCGYLALVTALSSEADFVFIPEAPPAVD
WRDKLCYKLEQERKSGQRLNIIIVAEGAIDREGKPITAELVKKVVVDNLQQDTRITVLGH
VQRGGSPSAFDRILGCRMGAEAVMALMEATPETEPCVVSLDGNQAVRLPLMECVRRTKAV
SQAMTDKNWELAVQLRGRSFARNLETYKMLTRLKPPKEAFDESGKPSEGLTLAVMHVGAP
ACGMNAAVRSFVRNCIYRGDTVLGIHDGVEGFISGNIVKMDWSDVTGWVGQGGAFLGTKR
TLPGDKKGEIAARIQQFNIQGLLIIGGFEAYQAGLEMYESRTQYPEFRIPLVVIPATISN
NVPGTDFSLGTDTALNEITEICDRIRQSAQGTKRRVFIVETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMTGGIQRGLILRNEKANENYNTDFIYRLYSEEGKGL
FTARMNVLGHMQQGGSPTPFDRNMGTKMAAKCLHWLVETIQKGPNNTADTACLLGIVKRQ
YKFTPLEELKSQTNFSQRVPKQQWWMKLRPLLRILAKHDSTYEEEGMYMTVEQGELDSES
VI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggatagtacaaagacgcagcgatttatagagcgaggctctcacaaagggaagggtctc
gcagtatttacgagtggcggtgactctcagggtatgaatgcagctgtacgctctgtggtt
aggatgggcatctatttagggtgtaaagtttactttatccgcgagggttatcagggtatg
gtagacggcggtgataatatagaggaagccaactggtcctctgttagttcaattattcac
aagggtggtactattattggttcagctcgctgcatggattttgtacaaaaagaaggtcgc
cttaaagctgcttgcaacttagtaactcgaggtattacaaacttagttgtaattggtggg
gatggctctcttactggtgctaacctctttcgtcaggagtggtctgaattgttagatgag
cttttggcgaataacaggattaccaaagatcaaagagaaaaatataaatatttgcatatt
gctggactggtgggctccattgataatgatttttgtggaactgacatgacaattggtacc
gattctgccttacatcgcattattgaagcaattgatgcaattgttagtacagcctactcc
catcaaaggacttttattatggaagttatgggtcgccactgtggatatcttgctctggtc
accgccttgtcatcggaagcagattttgtgtttattccggaagcaccacccgcagttgat
tggagagataaactttgctataagttagagcaggaacgtaagtctggtcagcgtttgaac
atcataatagtggcagaaggtgctattgaccgagaaggcaagccgattactgcagagctg
gtgaagaaggttgttgtggacaatcttcagcaagacaccagaataactgttctaggtcat
gttcaaagaggaggttcaccctcggcattcgacagaatattgggatgtcgtatgggtgcc
gaggcagttatggctttgatggaagcgaccccggaaacagagccatgtgttgtatctctg
gatggcaaccaagctgtccgactaccgctcatggaatgcgtgaggcgtactaaagccgtt
tcccaggctatgacagataaaaattgggagttagccgtgcaactacgcgggcgtagtttc
gcacgtaacctggagacatacaaaatgttgactcgtttgaagccaccgaaggaagctttt
gacgaatctggaaagccttctgaaggattaacattggcggtgatgcacgttggtgcgccc
gcctgtggtatgaacgcggccgtgcgctccttcgtacgtaattgcatctaccgtggtgat
actgtattgggcatacacgacggtgtagaaggattcattagcggcaatatcgttaagatg
gattggtctgatgtaaccggttgggtcggccagggtggtgcgtttttgggaacgaaacgt
actcttccaggagacaagaaaggcgaaatcgccgcgcgcatacaacaatttaatattcaa
ggattactcatcattggaggttttgaggcataccaagctggtttagaaatgtacgagtcg
cgtactcagtatcctgagtttcgtattccactagttgtgattccagccacgatcagtaac
aatgtacctggaaccgatttttcactgggaactgacaccgctcttaatgaaatcacggag
atctgcgacaggatccgccaatcggctcagggaacaaaacgtcgagtgtttatcgtggaa
acaatgggaggatactgtgggtacttggcgacgttggctggtctcgctggcggcgcagac
gcagcttacatctacgaagagaaattctctattaaagatttgcagcaagatgtgtaccat
atggcatccaaaatgactggcggaattcaacgcggtctcatacttagaaacgaaaaggcc
aatgagaactataacactgacttcatctatcgcctttactctgaagagggcaagggactt
ttcactgctagaatgaatgtattgggtcatatgcagcaaggaggttccccgacgccattc
gaccgtaatatgggaaccaaaatggccgccaagtgtctgcactggctcgtagagacaata
caaaagggacccaataataccgccgacacagcctgtcttctcggaatcgtcaagcgtcaa
tacaagttcacaccccttgaagagcttaagtcacagactaacttctcacaaagggtgcca
aaacaacagtggtggatgaaactccgtccactgcttcgtattttggccaaacatgattct
acctatgaagaggaaggaatgtacatgacagtcgaacagggagaactcgactctgaaagt
gttatttaa

DBGET integrated database retrieval system