KEGG   Pandoraea pnomenusa: X636_02265Help
Entry
X636_02265        CDS       T02950                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00020  Citrate cycle (TCA cycle)
prb00480  Glutathione metabolism
prb01100  Metabolic pathways
prb01110  Biosynthesis of secondary metabolites
prb01120  Microbial metabolism in diverse environments
prb01130  Biosynthesis of antibiotics
prb01200  Carbon metabolism
prb01210  2-Oxocarboxylic acid metabolism
prb01230  Biosynthesis of amino acids
Module
prb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X636_02265
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    X636_02265
Enzymes [BR:prb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     X636_02265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AHB74400
UniProt: V5UA69
LinkDB All DBs
Position
3578653..3580893
Genome map
AA seq 746 aa AA seqDB search
MSTQQSSIIYTLTDEAPLLATGAFLPIIRTFTAPAGVAIETSDISVAGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPDTNIIKLPNISASVFQLQSAIKELQSKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTIDKACDVRMELVTKSGKTIVLKPKVSLLDGEIIDSMFMSKKALCEFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYEKIEALPSTQREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
LGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIVEDGVANIVNIATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDHDTTGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNNRAKILAKTLDAATGKLLDNNKGPSPKTGELDNR
GSQFYLSMYWAQELAEQKEDAELAQRFAPLAKRLAENEKTIVAELAEVQGKPADIGGYYK
PDFDKLEQVMRPSKTFNAALASVATA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcagcaatccagcatcatctacaccctgaccgacgaagcaccgcttctggcc
accggcgccttcctcccgatcattcgcacgttcaccgcgccggccggcgtggcgatcgag
acgagcgacatctcggtggcaggtcgtatcctcggcgaattccccgaattcctgacggaa
gaacagcgcgtgccggacaacctcgccgagttgggccgcctcacgcaggatccggacacc
aacatcatcaagctgccgaacatcagcgcttcggtgttccagttgcagagcgccatcaag
gagctccaatcgaagggctacaaggtgccggactatccggaagacccgaagaccgacgaa
gagaaggccatccagaagcgctactcgaagtgcctgggctcggccgtgaacccggtgctg
cgcgaaggcaattcggatcgccgcgccccgttggccgtgaagaactacgccaagaagcat
ccgcacagcatgggcgaatggagcatggcttcgcgcactcacgtggcgcacatgaagcac
ggcgacttctaccacggcgaaaagtcgatgacgatcgacaaggcttgcgacgtgcgcatg
gaactcgtgacgaagagcggcaagaccatcgtgctcaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgagttctacgaagaa
cagatggaagacgcccgcaagaccggcgtcatgttctcgctgcacgtgaaggccaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggaagcc
ttcgagaagcacggcaagctgttcgacgaactgggcgtgaacgtcaacaacggcctcgtg
aacctgtacgagaaaatcgaggcgctgccgagcacgcaacgtgaagagatcatccgcgat
ctgcacgcctgccacgagcaccgtccggaactggcgatggtcgactcggccaagggcatc
tcgaacctgcacgcaccgaacgacgtgatcgtcgatgcctcgatgccggccatgatccgc
ctgggcggcaagatgtggggcgccgacggccgtccgaaggacaccaaggccgtgatcccg
gagagcacgttcgcccgcatttaccaggaaatcatcaacttctgcaagacgaacggcgca
ttcgacccgaccaccatgggcacggtgccgaacgtcggcctcatggcgcagaaggcagaa
gagtacggctcgcacgacaagacgttcgaaatcgtcgaagacggcgtggcgaacatcgtc
aacatcgccacgggcgaagtgctgctctcgcagaatgtggaagccggcgacatctggcgc
atgtgtcaggtcaaggacgccccgatccgcgactgggtaaagctcgcggtgaaccgcgtt
cgcaactcgggcatgccggccgtcttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtcgagacgtacctgaaggaccacgacaccaccggcctcgatatccag
atcatgtcgcaagtgcgcgccatgcgttacacgctcgagcgcgtgatccgcggcctggac
accatttcggtgaccggcaacattctgcgcgactacctgaccgacctcttcccgatcatg
gagctgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggtggcggcatg
tacgaaacgggcgccggcggctcggcaccgaagcacgtcaagcaactggtcgaggagaat
cacctgcgttgggactcgctgggtgaattcctggcgctggccgtgtcgctggaagacctc
ggtatcaagacgggcaacaaccgcgccaagatcctcgccaagacgctcgacgcggcaacc
ggcaagctgctggacaacaacaagggcccgtcgcccaagaccggcgagctcgacaatcgc
ggcagccagttctatctgtcgatgtactgggcacaggaactcgccgagcagaaggaagac
gccgagctggcccagcgcttcgcgccgctggccaagcgactggccgagaacgagaagacg
atcgtggccgaactcgccgaagtacaaggcaagccggccgacatcggtggctactacaag
cccgacttcgacaagctcgagcaagtcatgcgcccgagcaagacgttcaacgccgcgctg
gcaagcgtcgcgacggcgtaa

DBGET integrated database retrieval system