KEGG   Pandoraea pnomenusa: X636_07625Help
Entry
X636_07625        CDS       T02950                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    X636_07625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:prb02000]
    X636_07625
Enzymes [BR:prb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     X636_07625
Transporters [BR:prb02000]
 Other Transporters
  Pores ion channels [TC:1]
   X636_07625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AHB75335
LinkDB All DBs
Position
4726428..4727033
Genome map
AA seq 201 aa AA seqDB search
MKLYYSPGACSLSPHIVLREMGLTFELEKVDLQSKKTESGSDFRSVNPNGYVPLLALDDG
QVLTEGPAIVQYLADRAPEARLAPEAGTMERYRLVEWLNFISTELHKAFAPLFNPKTPEE
WKAIVNDLIAARLAYVEKKLDGQAYLMGDNFTVADAYLFTVLSWGKWVGVDIGRWPTLQS
YTNRISSRPTVQAALRAEGLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctactacagtcctggcgcttgttcgctttcaccgcacatcgtattgcgtgaa
atgggcttgacattcgagctcgaaaaagtcgatctgcaaagcaaaaagaccgagagcggt
tctgactttcgcagcgtcaaccccaatggttatgtgccgctgctggctctcgacgatggg
caggtgctcacggaaggtccggcgatcgtacagtacttggccgatcgggctcccgaagcg
cggctggcgcctgaagccgggacgatggagcgctatcgtttggtggaatggctaaacttt
atttcgaccgagcttcacaaggcttttgcgccgcttttcaatcctaaaacgccggaagaa
tggaaagccatcgtaaatgatttgatcgcggcgcgtctggcttatgttgaaaaaaagctc
gatggtcaggcctatctgatgggagataacttcacggttgctgatgcttatctgttcacc
gtgctgtcttggggcaagtgggtcggcgtagatatcggacgctggccgactttgcagagc
tatacgaatcgaatttcttctcgcccgaccgtgcaggccgcgctcagagccgaggggctg
atctaa

DBGET integrated database retrieval system