KEGG   Pandoraea pnomenusa: X636_07835Help
Entry
X636_07835        CDS       T02950                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00473  D-Alanine metabolism
prb00550  Peptidoglycan biosynthesis
prb01100  Metabolic pathways
prb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    X636_07835
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X636_07835
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    X636_07835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prb01011]
    X636_07835
Enzymes [BR:prb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     X636_07835
Peptidoglycan biosynthesis and degradation proteins [BR:prb01011]
 Precursor biosynthesis
  Amino acid ligase
   X636_07835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST ATP-grasp_4 TTL CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AHB75375
UniProt: A0A378YLB7
LinkDB All DBs
Position
complement(4768288..4769271)
Genome map
AA seq 327 aa AA seqDB search
MSAFDPKRFGKVGVLMGGRSAERQISLISGKGVLEALRSKGVDAHGFDTGMNDLAALAAQ
KFDRVFIALHGRYGEDGTLQGALEHLGIPYTGSGVLASALAMDKEMTKRVWINEGLPTPR
FKMLDADSDFDAVARDLGLPLIVKPSREGSTIGLTKVTEASQLKAAYEKAAALDPDVLAE
EFIDGDELTVPVLGVGTKGAAAARALPVIRIVAPDANYDYQNKYFKDDTRYECPPPLSVS
LQEEVQRLVLRAYLVLGCRGWARADVMLRKRDNKPYLLEINTSPGMTGHSLVPISARAAG
LSYEDLVVEILATATLDLHPNAQWKPE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcattcgatccgaaacgtttcggcaaggttggcgtcctgatgggcgggcgctct
gccgagcgtcagatctcgctgatttcgggcaaaggcgtactcgaggcgctgcgcagcaag
ggcgtggacgcccacggtttcgataccggcatgaacgatctggcggcgctggccgcgcag
aagttcgaccgcgtgttcattgcgctgcatgggcgctacggcgaggacggcacgctgcag
ggtgcgctcgagcatctcggcattccctacaccggcagtggcgtgctcgcctcggcgctg
gcgatggacaaggaaatgaccaagcgcgtgtggatcaacgaaggcctgcccacgccgcgc
ttcaagatgctcgacgccgacagcgactttgacgccgtggcgcgcgatctcggcctgccg
ctgatcgtcaagccgtcgcgcgaaggctcgaccatcggcctcacgaaggtcacggaagcg
tcgcagctcaaggcggcctacgagaaggctgccgcgctcgatcccgacgtgctcgccgag
gagttcatcgatggcgacgagctgaccgtgccggtgttgggcgtgggcacgaagggcgcg
gccgccgcgcgcgcgctgccggtgatccgcatcgtggcgccggacgcgaactacgactat
cagaacaagtacttcaaggacgacacgcgctacgagtgcccgccgccgttgtcggtgtcg
ttgcaggaggaagtgcagcgcctcgtgttgcgcgcctacctggtgctgggatgccggggc
tgggcgcgtgccgacgtgatgctgcgcaagcgcgacaacaagccgtacctgctggaaatc
aatacgtcgccgggcatgaccggtcactcgctggtgccgatctcggcacgtgcggcgggc
ctgtcgtatgaagacctggtcgttgaaatcctggcaaccgcgacgctcgatctgcatccg
aacgcgcagtggaagccagagtga

DBGET integrated database retrieval system