KEGG   Pandoraea pnomenusa: X636_18360Help
Entry
X636_18360        CDS       T02950                                 

Definition
(GenBank) permease
  KO
K07090  uncharacterized protein
Organism
prb  Pandoraea pnomenusa
Brite
KEGG Orthology (KO) [BR:prb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    X636_18360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AHB77199
UniProt: A0A378YXS0
LinkDB All DBs
Position
complement(1706514..1707266)
Genome map
AA seq 250 aa AA seqDB search
MTADLLLPLVAGACVAGFVQGLSGFAFSLVALSFWAWSLPPTVAGPLAAFCSLVGQLLGL
RAVRRAVPLERLAPFVLCGLVGVPFGVWILRYLDPIWFRAGIGAVLVIYCSILLLAARLP
RIRHGGRAADGVVGFIGGVMGGIGGLVGVVPTLWCTLRGWDKDMQRAVMQLFFIAMHTLT
ITLYVVHGVITTQTLHVFAIAVPSMILPTLAGAWAYRFLSDHAFRRMVLALLACSGVTLL
MGTVPELLAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgatctgttgctcccgcttgtcgccggcgcctgcgtggccggattcgtccaa
ggtctgtccggcttcgcgttcagcctcgtcgcgctctccttctgggcgtggtcgcttcct
ccgacggtcgccggcccgctcgccgccttctgttcgctcgtgggccagttgctggggctt
cgcgccgtgcgtcgggccgtgcccctcgagcggctcgcgccgttcgtgctttgcggactc
gtgggcgtgccgttcggggtgtggattctgcgctacctcgacccgatctggtttcgcgcg
gggatcggtgccgtgctcgtcatctactgctcgattctgctgctggcggcacgcctgcct
cgcattcggcacggcgggcgggccgccgacggcgtcgtgggcttcatcggcggcgtgatg
ggtggcattggcggactggtgggcgtggtccccacgctgtggtgcacattgcgcggttgg
gacaaggacatgcagcgcgcggtcatgcagctcttcttcatcgccatgcacacgctcacc
atcaccctgtacgtcgtgcatggcgtgatcacgacgcaaacgctgcatgtgttcgccatc
gccgtaccgtcgatgatcctgccgacgctcgccggcgcctgggcctaccggtttctctcc
gaccacgccttcagacgcatggtgcttgcgctgcttgcctgctcgggcgtcacgctgctc
atgggcaccgtgccggagctgctcgcgcggtag

DBGET integrated database retrieval system