KEGG   Pandoraea pnomenusa: X636_19885Help
Entry
X636_19885        CDS       T02950                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00020  Citrate cycle (TCA cycle)
prb00190  Oxidative phosphorylation
prb00650  Butanoate metabolism
prb01100  Metabolic pathways
prb01110  Biosynthesis of secondary metabolites
prb01120  Microbial metabolism in diverse environments
prb01130  Biosynthesis of antibiotics
prb01200  Carbon metabolism
Module
prb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X636_19885
   00650 Butanoate metabolism
    X636_19885
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    X636_19885
Enzymes [BR:prb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     X636_19885
    1.3.5.4  fumarate reductase (quinol)
     X636_19885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like GIDA Pyr_redox_3 NAD_binding_8 Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AHB77455
LinkDB All DBs
Position
2009668..2011443
Genome map
AA seq 591 aa AA seqDB search
MAAIKNSLPRRRFDVVIVGAGGSGMRASLQLAKAGLSVAVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCRQAPNAVYELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTHFFVEWMALDLIRNEEG
DVLGVSALELETGDVYLLEGKCTLFATGGAGRVYAASTNAFINTGDGLGMAARAGIPLED
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNGDYVLLDLSHIGAETIMKRLPSIREIALKFANVDAIKEPIPVVPTIHYQ
MGGIPTNYNGQVVMQKDGASVPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVDFVKNHGEHKPLPADAGENALARLGRLEASSSGEYAQDIANDIRATMQKHAGVFRTS
DLLKEGVDEIKQVAERVSHVHLKDKSKVFNTARMEALEVDNLIEVAKATMIAAEARKESR
GAHAHSDYPERDDANWMRHSLFFSEGNRLEYKPVQMKPLTVDSVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaaattcgctgccgcgccgccgctttgacgttgtcatcgtgggcgca
ggcggttcgggcatgcgtgcgtcgctgcaactggccaaggccggtctgtcggtcgccgtg
ctgtccaaggtgttccccacccgttcgcataccgtcgccgcacagggcggcattggtgct
tcgctcggcaacatgagcgaagacaactggcactatcacttctacgacaccatcaagggt
tccgactggctcggcgaccaggatgcgatcgagttcatgtgccgccaggcgccgaacgcc
gtctacgagctcgagcacttcggcatgccgttcgaccgtaacccggacggcacgatctac
cagcgcccgttcggcggccacacggccaactatggcgagaagccggttcagcgcgcttgc
gcggcggccgaccgtaccggtcacgcgctgctgcacacgctgtatcaacagaacgtggct
gccaagacccacttcttcgtggaatggatggcgctcgacctgatccgcaacgaagagggc
gatgtcctcggcgtgtcggcgctggagctcgaaaccggtgacgtctacctgctcgaaggc
aagtgcacgttgttcgcgaccggcggtgccggccgtgtctacgcggcgtcgaccaacgcg
ttcatcaataccggcgacggtctgggcatggcggcgcgtgcgggcattccgctcgaagac
atggaattctggcaattccacccgaccggcgtggccggcgcgggcgtgttgattaccgaa
ggcgtgcgcggcgagggcggtattctgcgcaactcgaacggcgagcgtttcatggagcgc
tatgccccgacgctgaaggatctggcgccgcgtgacttcgtgtcgcgttcgatggaccag
gaaatcaaggaaggccgcggctgcggcccgaacggcgactacgtgctgctcgacctctcg
cacatcggtgccgagacgatcatgaagcgtctgccgtcgatccgtgaaatcgcgctgaag
ttcgccaacgtggacgcgatcaaggaaccgatcccggtcgtgccgaccattcactatcag
atgggcggcatcccgacgaactacaacggtcaggtcgtcatgcagaaggacggcgcatcg
gtgccggtcaacggcttctacgccgtgggcgagtgctcgtgcgtgtcggtccacggtgcg
aaccgtctgggcacgaactcgctgctcgacctggtggtgttcggccgtgcggccggcaac
cacatcgtcgatttcgtgaagaaccacggcgaacacaagccgctgcccgccgatgccggc
gagaacgcgctcgcgcgtctggggcgtctggaagcgtcgagctcgggtgaatacgcccag
gacatcgccaacgatatccgcgcgacgatgcagaagcacgccggcgtgttccgcacgtca
gacctgctcaaggaaggcgttgacgagatcaagcaagtggccgagcgtgtctcgcacgtc
cacctgaaggacaagtcgaaggtgttcaacacggcgcgcatggaagcgctcgaagtcgac
aacctgatcgaagtggccaaggccaccatgatcgcagccgaagcccgcaaggaaagccgc
ggcgcccacgcgcacagcgattatccggagcgcgacgacgccaactggatgcgccactcg
ctgttcttcagcgaaggcaaccgtctggaatacaagccggtgcagatgaagccgctgacc
gtcgactcggtcccgcccaaggcgcggacgttctaa

DBGET integrated database retrieval system