KEGG   Pandoraea pnomenusa: X636_19890Help
Entry
X636_19890        CDS       T02950                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00020  Citrate cycle (TCA cycle)
prb00190  Oxidative phosphorylation
prb00650  Butanoate metabolism
prb01100  Metabolic pathways
prb01110  Biosynthesis of secondary metabolites
prb01120  Microbial metabolism in diverse environments
prb01130  Biosynthesis of antibiotics
prb01200  Carbon metabolism
Module
prb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X636_19890
   00650 Butanoate metabolism
    X636_19890
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    X636_19890
Enzymes [BR:prb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     X636_19890
    1.3.5.4  fumarate reductase (quinol)
     X636_19890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer2 Fer4_4 Fer4 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AHB77456
LinkDB All DBs
Position
2011456..2012160
Genome map
AA seq 234 aa AA seqDB search
MMKRIFEVYRYDPDKDAAPYMQTYEVELDGHERMLLDALVKLKKLDEGIAFRRSCREGVC
GSDAMNINGKNGLACLTNMNDLPNKIVLKPLPGLPVIRDLIVDMTHFFNQYHSIKPYLIN
PEPAPEKERLQSPEQRDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDTATSERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atcatgaaacgcatttttgaagtctaccgctacgatccggacaaggacgccgcaccgtac
atgcagacctacgaggtcgaactcgacggtcatgagcgcatgctgctcgacgccctggtc
aagctcaagaagctcgacgaaggtatcgccttccgccgctcctgccgtgaaggcgtgtgc
ggttcggacgcgatgaacatcaacggcaagaacggtctggcctgcctgaccaacatgaac
gatctgccgaacaagatcgtgctcaagccgttgccgggcctgcccgtcattcgcgacctc
atcgtcgacatgacgcacttcttcaaccagtaccactcgatcaagccgtatctgatcaac
cccgagccggcaccggagaaggaacgtctgcagtcgcccgaacagcgtgacgagctcgac
ggcctgtacgagtgcatcctgtgcgcttcgtgctcgacgtcgtgcccgagcttctggtgg
aatccggacaagttcgtcggcccggccggtctgctccaggcctatcgcttcatcgcggac
agccgcgacacggcgaccagcgaacgtctggacaacctggaagatccgtatcgcctgttc
cgctgccatacgatcatgaactgcgtggacgtgtgcccgaaggggctgaacccgacgaag
gcgatcggcaagatcaaggagctgatggtgcgtcgcgccgtctga

DBGET integrated database retrieval system