KEGG   Pandoraea pnomenusa: X636_23000Help
Entry
X636_23000        CDS       T02950                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
prb  Pandoraea pnomenusa
Pathway
prb00640  Propanoate metabolism
prb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    X636_23000
Enzymes [BR:prb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     X636_23000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C ADH_N_assoc Sacchrp_dh_NADP NADH_4Fe-4S ThiF Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AHB77975
UniProt: A0A378YDS4
LinkDB All DBs
Position
complement(2671777..2672814)
Genome map
AA seq 345 aa AA seqDB search
MKALVFHGPQQISLEDRPMPEIQDPTDAIVRVLKTTICGTDLHILKGDVPTVEPGRILGH
EGVGEVVQTGNAVTAFKPGDRVLISCISSCGKCAACRRGMYSHCAAGGWILGNRIDGTQA
EYVRTPHADTSLYHAPDGVDDDALVMLSDILPTGFECGVLNGKVQPGSSVAIVGAGPIGL
AALLTAQFFSPAQIIVVDPDLARLEVATRFGATSVISPTREDAAEAVRRLTGGQGVDTAI
EAVGVPATFELCEAIVAAGGIIANVGVHGRKVDLHLESLWDRNISITTRLVDTAATPMLL
KTVASGRLTPGALITHHFSLADILNAYRTFGDAANTHALKVIIAP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctcgtatttcacggtccccaacagatatcgctcgaagatcggcccatgccg
gaaatccaggacccgaccgacgccatcgtgcgcgttctgaaaacgacgatatgcggcacc
gacctgcacatcctgaagggcgacgtgccgacggtcgagccgggccggatcctgggccac
gaaggggtcggggaggtcgtgcaaacgggcaacgccgtcacagccttcaagcccggcgac
cgggtgttgatctcatgcatctcgtcgtgcggcaagtgcgcggcctgccggcgcggcatg
tattcgcattgcgccgccggaggatggattctcggcaatcgcatcgacggcacccaggcc
gaatacgtcagaaccccgcacgccgacaccagcctttaccacgcgccggacggcgtggac
gacgacgcgctggtcatgctgagcgacattctgcccacgggcttcgaatgtggcgtgctc
aacggcaaggtgcaaccgggcagcagcgtggccatcgtcggggcgggaccgatcgggctc
gccgcgttgctcacggcgcagttcttcagcccggcccagatcatcgtcgtcgatcccgac
ctcgcgcggctggaggtggccacccgattcggcgccacctccgtgatctcgcccacaagg
gaagatgcggccgaggccgtcaggcgcctgaccggcgggcagggcgtcgacacggccatc
gaggcggtgggcgtacccgcgacattcgaactttgcgaggcgatcgtcgccgccgggggc
atcatcgccaacgtgggcgtgcacggccgcaaggtcgacctgcatctcgaatcgctgtgg
gacaggaacatcagcatcacgacccgtctggtcgataccgcggcaacgccgatgctgctc
aagaccgtggcctcggggcgtctgacgccgggtgcactgatcactcaccacttctcgctt
gccgatatcctgaatgcctaccggacgttcggcgatgcggccaatacacatgcgttgaag
gtcatcatcgcgccatag

DBGET integrated database retrieval system