KEGG   Prochlorococcus sp. MIT 0604: EW14_0062Help
Entry
EW14_0062         CDS       T03304                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
prc  Prochlorococcus sp. MIT 0604
Pathway
prc00970  Aminoacyl-tRNA biosynthesis
prc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EW14_0062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:prc03029]
    EW14_0062
Enzymes [BR:prc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EW14_0062
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EW14_0062
Mitochondrial biogenesis [BR:prc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EW14_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIQ94090
UniProt: A0A089P5I2
LinkDB All DBs
Position
67130..68602
Genome map
AA seq 490 aa AA seqDB search
MNNLESWEAVIGLETHVQLNTKSKIFTSASTAFGDAPNTHIDPVVCGLPGTLPVLNETVL
EYAVKTSLALNLNVAEHCKFDRKQYFYPDLPKNYQISQFDEPLAENGWLEVEIIEKDKEP
YIKKIGIERLHMEEDAGKLVHSGSDRLAGSKYSLVDYNRAGIALCEIVSKPDIRSGKEAS
EYASEIRRTVRYLGVSDGNMQEGSLRCDVNISVRKGPDAPFGTKVEIKNMNSFSAIQKAC
DYEIARQIEVYENGGKIVQETRLWDEAKQLTKSMRLKEGSSDYRYFPDPDLGPIEITKAQ
QEIWFKELPELPSMKRNKYVLQFGLSAYDARVISDEISMANFFEETVANGAEAKLASNWV
TSDIVGYLKSNKLSFRELKLTPENLAEMISMISKNIISGKIAKEILPELIQKNISPKKLV
EEKGLAMISDSSSILPIIDELINEYPNEVQAFKNGKSKLLGFFVGQLMKRTKGKADPKLA
NKLLMEKLNS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttggaatcttgggaagctgtgattggtttggaaactcatgtacagcttaat
acgaaaagtaaaatattcacatctgcgtcaacagcttttggtgatgcacctaatacgcat
atagatcctgtagtttgtgggttaccaggaactcttccagttttgaatgagactgttctt
gagtatgctgtaaaaacttctttagcattaaatttaaatgttgcagaacattgtaaattt
gatagaaaacaatatttttatcctgatctgcctaaaaattatcaaatctcacaatttgat
gagccactagctgaaaatggctggttagaggttgaaataattgaaaaagacaaagaacct
tatatcaaaaaaattggtatagaaaggcttcatatggaagaagacgcaggaaaactagtt
cattcaggtagtgacagattagctggttctaagtattctttagttgactacaatcgcgcc
ggaatagcactttgtgagattgtaagtaaaccagatattagatcaggtaaagaggcatct
gaatatgcttcagagattagaagaacagttagatatttaggtgtatcagacggaaatatg
caagagggttcattacgctgtgatgtcaatatttcagtgagaaaaggacctgatgctcct
tttggtaccaaagtggaaataaaaaatatgaattcattttctgcaattcaaaaggcttgt
gattatgaaatagccagacaaatagaagtttatgaaaatggaggaaaaattgtccaagaa
acaaggttatgggatgaagctaagcaattaactaaaagtatgagattaaaagaaggtagc
agtgactatagatattttcctgatcctgacttagggccaattgaaataacaaaagcccaa
caagaaatatggtttaaagaactaccagaattaccctcaatgaaaagaaataaatatgtc
cttcaatttgggttatctgcatatgatgcaagggtaatttctgatgaaataagcatggca
aacttttttgaagaaacagtagcaaatggcgccgaggccaaactagcttcaaattgggta
acaagtgatattgtgggctatttaaaatcaaacaaactaagttttagagaattaaagctt
actcctgaaaatcttgctgaaatgattagcatgatttcaaaaaatataattagtggaaaa
attgcaaaagaaattttacctgaacttattcaaaaaaatatttctccgaaaaaattagtt
gaagaaaaagggttggcaatgatatctgattcttcaagtattttaccaataattgatgaa
cttataaatgaatatccaaatgaagttcaagcatttaaaaatggtaaatctaagttactc
ggtttttttgttggtcaacttatgaaaagaactaaaggtaaagctgacccgaaacttgca
aataaacttcttatggaaaaattgaatagctga

DBGET integrated database retrieval system