KEGG   Prochlorococcus sp. MIT 0604: EW14_0442
Entry
EW14_0442         CDS       T03304                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
prc  Prochlorococcus sp. MIT 0604
Pathway
prc00010  Glycolysis / Gluconeogenesis
prc00020  Citrate cycle (TCA cycle)
prc00620  Pyruvate metabolism
prc01100  Metabolic pathways
prc01110  Biosynthesis of secondary metabolites
prc01120  Microbial metabolism in diverse environments
prc01200  Carbon metabolism
Module
prc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:prc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EW14_0442
   00020 Citrate cycle (TCA cycle)
    EW14_0442
   00620 Pyruvate metabolism
    EW14_0442
Enzymes [BR:prc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EW14_0442
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL DUF406
Other DBs
NCBI-ProteinID: AIQ94465
UniProt: A0A089P6J5
LinkDB
Position
386722..388071
AA seq 449 aa
MPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVLMPAGST
APVGETIGIIVENEDEIASVQEQNKGNQPEVSSSDQLELVSNKIEEKPVVQSEIVEKQEK
EVVLMSEKAAPSFKSDQINAATSNVSSRIIASPRAKKLASQMGVDLAKVHGSGPHGRIQA
DDILKANGQPVSIPWIGEGGSPASIPSANLGVESKSETSGNSFGNPGETVQFNTLQKAVN
KNMESSLDVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQVNSSFS
ENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRLKQLEPDEY
STGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDSSISVKKIMQVNLTAD
HRVIYGADGASFLKDLANLIENEPETLVS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgccagccttgagttctactatgacggagggcaagattgtggaatggttgaaaaatccg
ggagataaagttgaaagaggtgaatctgtcttggttgttgaatctgacaaggcagatatg
gatgttgaatcttttcaagatggatatcttgcggctgttttaatgcctgccggcagcact
gcaccagtaggagagactatcggtattattgtagaaaatgaggatgagatagcttctgtt
caagaacaaaataagggaaatcaacccgaagtttctagttcggatcaacttgaattggta
agcaataaaattgaagaaaaacctgtagttcaaagtgaaattgttgaaaaacaagaaaaa
gaagtcgtattaatgagtgaaaaggcagccccatcttttaaaagtgatcaaataaatgct
gctacgagtaatgtttcttcgaggataattgcatctccaagagctaaaaaacttgcctct
caaatgggtgttgatttagcaaaggttcatggatctggccctcacggaaggattcaagcc
gatgatattttaaaagctaatggccaaccagtctctattccatggataggcgaaggtggt
tctcctgcaagtatccctagtgcaaatttgggagtcgaaagtaaatcagaaacttcagga
aatagttttggcaatcctggagaaacagttcaatttaatactcttcaaaaagcggtaaat
aaaaatatggaatctagtttagatgttccatgttttagggtaggttactctatcaataca
gataaattagataatttctacaaaaaggtaaaacagaacggagttactatgactgcttta
cttgtaaaggcagttgcaaagacactaaagaaacatcctcaagttaactcaagcttttca
gaaaatggaatttcttatccagaaaatataaatattgctgttgctgttgcaatggaagat
gggggactaataactccagtattaaaagaaccatgcaatactgatttatttgaattatct
agggaatggaaagatctcgtaaaaagatcgagattaaaacaattagaaccagatgaatac
tcaacgggaacatttaccttatctaaccttggtatgtttggtgttgatagatttgacgca
atactacccccagggaccggtgccatcttagcgatagcatcatcaaaaccaactgttgta
gctaatagtgatagttcaatatctgttaaaaaaataatgcaagtaaatcttacagctgat
cacagagtgatctatggagctgatggtgcttcattcttaaaagacttggctaacctgatt
gaaaatgagccagagacacttgtatcttaa

DBGET integrated database retrieval system