KEGG   Prochlorococcus sp. MIT 0604: EW14_0589Help
Entry
EW14_0589         CDS       T03304                                 

Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein ChlL
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
prc  Prochlorococcus sp. MIT 0604
Pathway
prc00860  Porphyrin and chlorophyll metabolism
prc01100  Metabolic pathways
prc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EW14_0589
Enzymes [BR:prc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     EW14_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH AAA_31 CbiA ArsA_ATPase ParA AAA_24 MeaB SRP54 MipZ NB-ARC AAA_25 RNA_helicase AAA_26 CBP_BcsQ PRK AAA_22
Motif
Other DBs
NCBI-ProteinID: AIQ94612
UniProt: A0A089P4M3
LinkDB All DBs
Position
complement(514254..515141)
Genome map
AA seq 295 aa AA seqDB search
MTSTINRPLDGEGSVQVKQDPKINIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKV
LQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTDFMFEGFNGVMCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVSAIKAKAKNYKVRLGGVVANRSKETDQIDKFNERTGLKTMAHFKDVDAIRR
SRLKKCTIFEMEPTEDVIEVQNEYISLAKNMLENVEPLEGNPLKDREIFDLLGFD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtactataaatagacctcttgatggagaaggaagtgttcaagtaaagcaagat
ccaaaaataaatattgaggaaggggctttagttattgcagtctatgggaagggtggcatc
ggaaaatcaactacatcatcaaacctttctgcagcattctcaaaattaggtaaaaaggtt
ctacaaattggatgtgatccgaaacacgatagcactttcactttgacgcacaaaatggtt
cctacagttatagatattctcgaagaggtggattttcatagcgaagaattgaggccaacc
gatttcatgtttgaaggttttaatggcgtaatgtgcgttgagagtggaggtcctcctgct
gggacagggtgcgggggttatgtaaccggtcagacagttaaattattaaaagaacatcat
ttattagaagatactgacgttgttatttttgatgtcctaggagacgtcgtttgcggagga
tttgccgctccattgcaacatgcaaattattgtctaattgttactgctaatgacttcgat
tcaatattcgctatgaatagaattgtctctgcaattaaagcaaaagcaaaaaattataaa
gtcagattaggtggggtagtagcaaatagatcaaaagaaacagatcaaattgataaattc
aatgaaagaacaggtttaaaaactatggcccactttaaagatgtcgacgccattagaaga
tcaagactaaaaaaatgcaccatttttgaaatggaacctactgaagatgttattgaagtt
caaaatgaatatatatctcttgccaaaaatatgcttgaaaacgtagaacctttagaaggt
aatccacttaaagatagagaaatttttgatttattaggatttgattag

DBGET integrated database retrieval system