KEGG   Prochlorococcus sp. MIT 0604: EW14_0596Help
Entry
EW14_0596         CDS       T03304                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
prc  Prochlorococcus sp. MIT 0604
Pathway
prc00630  Glyoxylate and dicarboxylate metabolism
prc00710  Carbon fixation in photosynthetic organisms
prc01100  Metabolic pathways
prc01120  Microbial metabolism in diverse environments
prc01200  Carbon metabolism
Module
prc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
prc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
prc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:prc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EW14_0596
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EW14_0596
Enzymes [BR:prc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     EW14_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AIQ94619
UniProt: A0A089QJ25
LinkDB All DBs
Position
520859..522274
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPEYVPLDTDLLACFKCTGQEGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRCYRIEDVPGDPEAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTANTPE
ELYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaagtatgatgcaggggtaaaggagtacagagatacctactggactccagaa
tatgtacccctagacaccgatttactagcctgtttcaaatgtacaggtcaagaaggtgtc
cccagagaagaagttgcagcagctgttgctgctgaatcttcaacaggtacttggtcaaca
gtttggtccgagttacttacagatttagaattttataaaggacgttgttatcgaatcgaa
gacgttcctggagaccctgaagctttttatgcttttattgcatatcctttagatcttttt
gaagaaggttctattacaaacgtattaacatctcttgtaggaaacgtttttggatttaaa
gctcttagacatctacgtctagaagatattagattcccaatcgctttcatcaaaacttgt
ggtggtccaccaaatggaatcgtagttgaaagagatcgtttaaacaaatatggaagacct
ctacttggttgtaccattaaacctaaattaggattatctggtaaaaactatggccgagtt
gtatatgagtgccttagaggtggtctcgatttaacgaaggatgacgagaatataaactct
cagccattccaacgttggagagaaagatttgagtttgttgcagaagcagttaagcttgct
cagcaggaaactggcgaagttaaaggtcactacttaaactgtactgccaacactcctgaa
gaactttacgaaagagctgaatttgcaaaagagctagatatgccaatcatcatgcatgat
tatataactggcggttttactgcaaatactggattagcaaactggtgtcgtaaaaatggc
atgcttctacatattcatagagcgatgcatgctgttattgatagacatccaaaacacggt
atccatttcagggttctagcaaaatgtttgagactctccggaggcgatcaactacatact
ggaactgttgttggaaaactagaaggtgatcgtcaaacaactcttggttacattgacaac
ttaagagagtcatttgttcccgaagatagatcaagaggtaacttctttgatcaagattgg
ggttcaatgccaggagtatttgctgtcgcatcaggtggtattcacgtatggcatatgcct
gcactcctagcgatttttggagatgattcttgtcttcagtttggtggaggaacacatggt
catccatggggttcagctgctggagctgcagccaacagagttgctttagaagcttgcgta
aaagcacgtaatgctggtcgcgaaatcgaaaaagagagtagagacattcttatggaagct
gctaaacacagtcctgaattagctatcgctcttgaaacttggaaggaaattaagtttgaa
tttgataccgtcgacaaactagacgttcaaggttaa

DBGET integrated database retrieval system