KEGG   Prochlorococcus sp. MIT 0604: EW14_0612Help
Entry
EW14_0612         CDS       T03304                                 

Definition
(GenBank) Glutaredoxin-like domain/phycoerythrin related domain fusion
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
prc  Prochlorococcus sp. MIT 0604
Pathway
prc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:prc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EW14_0612
Enzymes [BR:prc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EW14_0612
Transporters [BR:prc02000]
 Other Transporters
  Pores ion channels [TC:1]
   EW14_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N_4 GST_N GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AIQ94635
UniProt: A0A089P6X9
LinkDB All DBs
Position
complement(534847..536076)
Genome map
AA seq 409 aa AA seqDB search
MNGILTWDDLNKFEVEDLDRVHGINNSYANLRLFGHSENDLLVTLYRDRHSWCPYCQKIW
LWLEFKKIPYRVEKINMFCYGQKESWFLEKVRSGKLPAIEFKGQVITESDDIIAFLENEF
GALGSFIRSSHLIKIRKLEREIFRSWCNWLCRESFNFIDNSFRKKRFKESISKLDEILSS
SESGFVDPSVSNTGDIEPGVGDLIFIPYMERMNASLIYYKGFNLRSSYRNVDNWLTLFEG
KSAYRGTQGDFHTHSHDLPPQMGGCYKENNEQQITFSKLIDTGEGLGNYELNQNYDSKYY
AIIALKRVIKHKDNLLKVNPYNKECFEESLRSALTHMITSEVIIPEKFSGISLRYLKNRI
SVPRDMPLISARLLRQSLNKIESLSDVNEIDKIPFRHRYDQDPRNFASG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggattttgacttgggatgatttaaataaatttgaagttgaagatcttgataga
gtccatggtataaataattcctacgcaaacttaagattatttggacatagtgaaaatgat
ttattagttaccctctatagggataggcattcttggtgtccttactgtcagaagatatgg
ttatggcttgaatttaagaaaattccatacagagtcgagaaaataaatatgttttgctac
ggccaaaaagaaagttggttccttgaaaaagtcagatcggggaaattacctgcaattgaa
tttaaagggcaagttataacagaaagcgacgatatcatagcttttttagaaaatgaattt
ggagcacttggatcttttattagatctagtcaccttatcaaaattcgaaagttagaaaga
gaaattttcagatcctggtgtaattggctctgccgagaaagctttaattttatagataac
tcttttagaaaaaaaagatttaaagaatccatttctaaactcgatgaaatcttaagtagc
tcagaatcagggtttgttgatccctcagtttctaacacgggtgatatagagcctggtgtg
ggagatttaatttttattccctatatggagagaatgaatgcatcattgatctactataaa
gggtttaatttaaggtctagttatcgtaatgtagataactggcttaccctttttgagggg
aaaagtgcttatagaggcactcaaggagattttcatactcattctcatgatttaccccca
caaatgggaggatgctataaagaaaacaatgaacaacagattactttctcaaagttaata
gatactggggagggtttaggtaattatgaattaaaccaaaattatgactcaaaatattat
gcaataattgctcttaaaagagtaataaagcataaagataatttactaaaagtaaacccg
tacaataaagaatgttttgaggaatcgttgagatcagctttaacccatatgatcacaagt
gaagtaataatccctgaaaaattttcgggaatctcattaagatacttaaaaaataggatc
tcagttccaagagatatgccacttatttcagctaggttattaagacaatcattaaacaaa
attgaatcgcttagtgatgtcaatgagatagataagataccttttaggcatagatatgat
caagatcctagaaattttgcctctggttaa

DBGET integrated database retrieval system