KEGG   Prochlorococcus sp. MIT 0604: EW14_1933Help
Entry
EW14_1933         CDS       T03304                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
prc  Prochlorococcus sp. MIT 0604
Pathway
prc00620  Pyruvate metabolism
prc00680  Methane metabolism
prc00710  Carbon fixation in photosynthetic organisms
prc01100  Metabolic pathways
prc01120  Microbial metabolism in diverse environments
prc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EW14_1933
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EW14_1933
   00680 Methane metabolism
    EW14_1933
Enzymes [BR:prc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EW14_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIQ95940
UniProt: A0A089PAW5
LinkDB All DBs
Position
complement(1614104..1617040)
Genome map
AA seq 978 aa AA seqDB search
MDLISNNDPLDKNRLLIEDLWESVLREECPDDQAERLIQLKELSYSKQIDGNSSKTSKNE
IVEIVNSMDLSESIAAARAFSLYFQLVNILEQRVEEDRYIQSFTNKDVQKSPDNLDPFAP
ALARQNAPVTFRELFYRLRKLNVPPGKLEELLQEMDIRLVFTAHPTEIVRHTIRHKQTRV
ANLLKKIQIEQFLTKEEKNSLKTQLKEEVRLWWRTDELHQFKPSVLDEVDYALHYFQQVL
FNAMPQLRCRIAEALTENYPDVQMPSESFCNFGSWVGSDRDGNPSVTPDITWRTACYQRQ
LMLERYIIAISNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARATRYRSEPYRLK
LSYILEKLRLTQERNNLLADSGWKFDLEGEIDNKNLEKVENLYYQSVNEFTYDLELIKNS
LISTDLNCESVNTLLTQVHIFGFSLASLDIRQESTRHSEAIQELTNYLDLSVHYDQMSEE
EKIKWLIEELNTKRPLIPSDVNWTNTTEETFAVFKMVKRLQQEFGSRICHSYVISMSHSA
SDLLEVLLLAKEMGLFDQNSQKSKLLVVPLFETVEDLKRAPEVMEKLFKLDFYRSLLPKV
GESSKPLQELMLGYSDSNKDSGFVSSNWEIHRAQISLQNLSSRNNILLRLFHGRGGSVGR
GGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTTAVIQNSLVNNR
LDATPEWNQLMSRLAETSRSHYRRLVHENPDLLNFFQEVTPIEEISKLQISSRPARRKKG
AKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSSELNSDPKQIELLRVLHQRWPFFRML
ISKVEMTLSKVDLEVARYYVDTLGSKENKDSFDDIFEVISKEYILTKSLILEITGKNKLL
ESDRDLKSSVSLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFIIDQDESRRAYSRSELL
RGALLTINGIAAGMRNTG
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgattagtaacaatgatccacttgataaaaatcgtcttttaatagaagatcta
tgggaatctgtgctcagagaagaatgcccagatgatcaagcagagaggttgattcagctt
aaagaattaagttattcaaaacaaattgatggtaatagttcaaaaacttctaaaaatgaa
atagttgaaattgtaaattctatggatttatcagaatccatagcagcagcgagggcgttt
tcattatattttcaactcgtgaatattttggaacaaagagttgaagaagatagatatatt
caaagttttaccaataaggacgttcaaaaatcgcccgataatcttgatccttttgctcca
gcattggctagacaaaatgctccagtaacttttagagaattattttacaggctgaggaaa
ttaaatgtaccacctgggaaattagaagagttattgcaggaaatggatatccgtttagtt
tttactgcacatcccaccgagatagtgagacatacgattagacataagcaaacaagagta
gcaaatttattaaaaaaaatacagattgagcaatttctaacaaaagaagaaaaaaattct
ctaaaaacccaattaaaagaggaagtaagactttggtggagaacagatgaactgcatcaa
tttaaaccttcagttttagatgaagtagattatgctttgcattattttcagcaagtttta
tttaatgcgatgcctcaattgaggtgcaggatcgcagaagcacttactgaaaattatcca
gatgttcagatgccctctgaatctttttgtaacttcggttcttgggtaggctccgataga
gacggtaatccatcggttactcccgacataacatggagaactgcttgctaccaaaggcag
ttaatgttggaaagatatattattgcgatatctaatcttagagatcaattaagtgtttcg
atgcagtggagccaagtcagttcctctctattagagtcactcgaaacggatagggtcaag
ttcccagaaatctatgaagctagagctacaaggtatagatcagaaccttacagattgaaa
ttaagttatattttagagaaattaaggttaacacaggaaagaaataatttattagctgat
agtgggtggaaatttgacttggagggagaaattgacaataaaaatctagagaaagttgaa
aacttatattaccaatcagtaaacgaatttacttatgatctcgaattgattaaaaatagc
ctgattagtacagatttaaattgtgaatctgtaaacaccctacttactcaggttcacatt
tttggattttctttagcaagtttagatattcgtcaagagagtacaaggcatagtgaggct
atacaagagcttacaaattatcttgatctatcagtccattatgaccaaatgtctgaggaa
gagaaaattaaatggcttatagaggaattaaatacaaaaaggcctcttattccatctgac
gttaactggacaaacactacagaagaaacctttgcagtttttaaaatggttaagagatta
cagcaagaatttggaagtcgcatttgtcattcttatgtaatttcaatgagtcatagtgca
tctgacttgcttgaagttctcttactggcaaaagaaatgggactttttgatcaaaattcg
caaaagtcaaaattattagttgttcctctttttgaaactgtagaagaccttaaaagagca
ccagaagtaatggaaaagttgttcaaattagatttttatagatcattattaccaaaagtg
ggagaatcttctaaacctctgcaagaattaatgcttggatattctgatagcaataaagat
tcggggtttgtttctagtaattgggaaattcatagagcccaaatatctcttcaaaatctt
tcaagtagaaataatatattgctaagactttttcatggaagaggtggttctgtagggaga
ggaggaggaccagcctatcaggcaatattggctcaaccaagcggtactttaaaaggtcga
ataaaaataacagaacaaggcgaagttttagcctctaaatatagtcttcctgaactggct
ttatacaatcttgagactgtcactacagctgtaattcaaaatagtttggtaaataataga
cttgacgctactccagaatggaatcaattaatgtctaggctggcagaaacatcaaggtct
cactacagacgattagtgcatgagaatcctgatttgttaaatttctttcaagaggtcact
ccaatagaagaaataagtaaattacagatatctagtaggcctgctagaagaaaaaaaggt
gcaaaagatttatcaagtctaagagctattccatgggtgttcggttggacacaaagcaga
tttcttttgccaagttggtttggagtaggcactgcattgtcatctgaattaaattcagat
ccaaaacaaattgaattattaagagttctccatcaaagatggccattttttaggatgctt
atttctaaggtagaaatgacattatctaaggtagatttggaagttgctagatattatgtt
gatacccttggtagtaaagaaaataaagattcttttgatgatatttttgaagtcatttct
aaagaatatattcttacaaaatctttaatacttgaaattacgggtaaaaataagcttctc
gaatctgatagagacttgaaatcatcagtaagcttgagaaataaaacgataatcccattg
ggctttttacaggtttcacttttaagaagactaagagaccagacaaggcaaccaccaata
agcgaatttattattgatcaagatgaatctagaagagcttacagtagaagtgaactattg
aggggggcacttttaactattaatgggatagcagctggcatgagaaatacaggttaa

DBGET integrated database retrieval system