KEGG   Pradoshia sp. D12: F7984_01925
Entry
F7984_01925       CDS       T06218                                 

Gene name
ligA
Definition
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
prd  Pradoshia sp. D12
Pathway
prd03030  DNA replication
prd03410  Base excision repair
prd03420  Nucleotide excision repair
prd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    F7984_01925 (ligA)
   03410 Base excision repair
    F7984_01925 (ligA)
   03420 Nucleotide excision repair
    F7984_01925 (ligA)
   03430 Mismatch repair
    F7984_01925 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:prd03032]
    F7984_01925 (ligA)
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_01925 (ligA)
Enzymes [BR:prd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     F7984_01925 (ligA)
DNA replication proteins [BR:prd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     F7984_01925 (ligA)
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     F7984_01925 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     F7984_01925 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     F7984_01925 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      F7984_01925 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD PTCB-BRCT HHH RNA_pol_A_CTD URO-D
Other DBs
NCBI-ProteinID: QFK70103
UniProt: A0A5J6XKF0
LinkDB
Position
367019..369034
AA seq 671 aa
MDIKEAQKRVAELQSLLNQYGYEYYVLDQPSVPDSVYDQTYKELVELESQYPELQTPDSP
TQRVGGQVLDTFAKVEHITPMLSLGNAFNESDLRDFDRRVNSGLGTDRYSYICELKIDGL
AVSLRYEEGLFVKGATRGNGTIGEDITANLKTIRSIPLRLNEPVTFEVRGEAYMPKKSFV
SLNAKKEENGEEPFANPRNAAAGSLRQLDPRIAASRNLDIFLYGIGETGETGVESHGEGL
DFLQKLGLKTNPHRRRCATIEDVLEYIEEWSAKRPELDYDIDGIVIKVDSLSQQEELGYT
AKSPRWAIAYKFPAEEVITILRDIELTVGRTGVITPTALLDPVRVAGTTVKRASLHNEDL
IREKDIRLGDHVVVKKAGDIIPEVVNVLFDKRTGEEKEFHMPTHCPDCDSELVRLEGEVA
LRCINPKCPAQIKEGMIHFVSRNAMNIDGLGEKVIIQLFDESLIKDVADIYKLTYDQLIN
LERMGDKSANNLLNAIEASKSNSLERLLFGLGIRHVGAKAARILAEEFEDMDRLMSANVA
ELTAINEIGDKMADAVVTYFNQEECQQLIDELKNAGVNMLYKGKKKNIAEATDSYFSGKT
IVLTGKMEKYGRTEAKELIEALGGTVTGSVSKKTDLVIAGEDAGSKLKKAQDLGIEIWDE
SNLLEELGKQG
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggatataaaagaagcgcaaaaacgagtggctgagcttcaatcactattaaaccaatat
ggatatgaatactatgttctcgaccagccatcagttcctgattctgtatatgatcagacg
tataaagagttggtggaattggagagtcaatatccggagctgcaaaccccagattcacct
actcaaagagttggtggacaagtgcttgatacgtttgcaaaagtagaacatattacaccg
atgctaagtcttggtaacgcctttaacgaaagtgatttgcgcgattttgaccgccgagta
aattcagggcttggtacagaccgatattcttatatatgtgaattgaaaatagatggactg
gcagtttccctgcgttatgaagaagggctatttgttaaaggggctacaagaggaaatgga
acaattggtgaggatattactgctaatcttaaaaccattcgttccatcccactccgattg
aatgaaccagttacatttgaggtacgcggtgaggcatatatgccaaagaaatcgtttgtt
tccttaaatgcaaagaaggaagaaaatggggaagagccatttgccaatccacgaaatgca
gcagcaggatccttgcgtcagcttgatccacgcatagctgcttcgcggaatttggatatt
ttcctttatgggattggtgaaacaggagaaacaggtgttgaatcccatggtgaaggactt
gactttcttcaaaaattaggattgaaaaccaatccgcatcgcagaagatgtgctacgatt
gaagatgtattagagtatattgaggaatggtcagccaaaaggcctgagcttgattatgat
attgatggaatcgtcatcaaagtcgattcactttctcaacaagaggaattaggatatact
gcaaaaagtccaagatgggcgattgcatataaattccctgcagaggaagtcatcactatt
cttcgcgatattgaattgactgtcggtcgtacaggcgttattacgccaaccgccttattg
gacccggtaagagtagcaggtacaacagttaaacgggcttcccttcataatgaggaccta
atccgtgaaaaagatattcggcttggagaccatgttgtcgtcaaaaaagccggtgatatt
attccggaggttgtcaatgttctgtttgataagcggacaggggaagaaaaggaattccat
atgccaacgcattgccctgactgcgatagtgagcttgttcgtttggaaggagaggtagct
ttgcgctgcatcaatccaaagtgtccagctcagattaaagaggggatgattcactttgtt
tcacgaaatgccatgaatattgatggtctgggtgaaaaagtcatcattcaattattcgat
gaatcgttaattaaggatgtagcggatatttataaattgacatatgaccagctgattaat
ttggagcgtatgggggataaatcagcgaacaatcttttgaacgctattgaagcatctaag
agcaactcattggagcgccttttatttggactgggaatccgccatgttggtgctaaggct
gcaagaatcctcgcggaagaatttgaagacatggatcgtctaatgtcggcaaatgtagct
gaattgacagctattaatgaaattggggacaaaatggctgatgcggttgtgacttatttt
aatcaggaagaatgccagcaattgatcgatgaattaaaaaatgctggggttaatatgctc
tataaaggtaaaaagaaaaatatcgctgaagctacagatagttatttttctggaaaaacc
attgtacttacaggaaagatggaaaagtacggacgaactgaagcaaaagagttgattgaa
gctttaggtggaactgtaacgggtagcgtaagtaaaaagacagatttagtaatagccgga
gaagatgccggatcaaaattaaaaaaagcccaggatttaggaattgaaatatgggatgaa
agcaatttactggaagaactgggcaagcagggatag

KEGG   Pradoshia sp. D12: F7984_03780
Entry
F7984_03780       CDS       T06218                                 

Definition
(GenBank) hypothetical protein
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
prd  Pradoshia sp. D12
Pathway
prd03030  DNA replication
prd03410  Base excision repair
prd03420  Nucleotide excision repair
prd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    F7984_03780
   03410 Base excision repair
    F7984_03780
   03420 Nucleotide excision repair
    F7984_03780
   03430 Mismatch repair
    F7984_03780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:prd03032]
    F7984_03780
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_03780
Enzymes [BR:prd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     F7984_03780
DNA replication proteins [BR:prd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     F7984_03780
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     F7984_03780
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     F7984_03780
   MMR (mismatch excision repair)
    DNA ligase
     F7984_03780
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      F7984_03780
SSDB
Motif
Pfam: DNA_ligase_aden BRCT DNA_ligase_OB PTCB-BRCT DNA_ligase_ZBD zinc_ribbon_2 OrfB_Zn_ribbon
Other DBs
NCBI-ProteinID: QFK70422
UniProt: A0A5J6XJC9
LinkDB
Position
773540..774757
AA seq 405 aa
MTHTDKYQLRLKEYLKQAGNPLLIKLLINGLTVEMTYQNGLLNKVIMVDQNHFEVDVTQV
VRISVDVPDKILFKGLLKVRAHVIHTFSDFEKLNRNGLYLHHKDLTKKILQQQMDYEQRK
LRVIVSNIVDIFGLDNDSGYNEIEQVEFLKNQGFHVVYYEQIENSIEGIHLFYETFMEYH
RQEIGYSVSGLQILSADSHDCNEGFILPFSSDEAILTVDDICPEVIPSGRIEPIVRIKAI
DLAGERYYSLRMHGFSLIKLMDIRIGDQVLMSDVQTIIGVEIEKRTGTETCFVLPEFCPN
CGDKVKNDGEQLYCTNSDCRNKPVFNREQHGIKGKTVVITGTLSIRRYDFRKLIEQAGGV
LAGAVTNQTDYLLMGSKGVGTVKYRKAKSLKVPIITEEQFRLMIE
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgactcatacagataaataccaactacgacttaaagaatacttaaagcaagctggcaat
cctttgcttatcaaattactcatcaatggtttaacagtagaaatgacatatcaaaatgga
cttcttaataaggtaatcatggttgatcaaaaccattttgaagtggatgtaactcaagtg
gttcgaatcagtgtagatgtccctgacaagattttgtttaagggattattaaaggtgagg
gcacatgtcattcacaccttctcggattttgaaaagttgaatcgaaatggcctgtattta
catcataaagatttaacgaaaaaaatactccagcagcagatggattatgagcaaagaaag
ctaagggtcattgtttcaaatattgttgatatattcggcttggataatgacagtggttat
aatgagattgaacaggtagagtttctaaagaatcaaggatttcacgtggtctattatgag
caaattgaaaatagtattgaaggaattcatttattttacgagacttttatggagtatcac
cgtcaagagataggctattccgtatcaggtctgcaaatactttctgctgattcacatgac
tgcaacgaagggttcatattacctttttcatctgatgaagcaattttaacagttgatgat
atttgtcctgaggtaattccatctggaaggattgagcctattgtcagaataaaagcgatt
gatctagcaggagaacgttattattcccttcggatgcatggattctctttaatcaagtta
atggatattcgaattggcgaccaggttttgatgtcggatgtacaaactattataggggtg
gaaatagaaaaacggacaggtacagaaacttgctttgtcctacctgaattttgccctaat
tgtggggataaagtaaagaatgatggtgagcaactatattgtacaaatagcgattgcagg
aataaaccggtattcaatcgagagcagcatggaataaaaggtaagactgtggttataact
ggtacactttcaataagaagatatgatttcaggaaattaattgaacaagctggtggagta
ctggcgggagcggttacgaaccaaacagattacttattaatggggtcaaaaggggtaggg
acagtcaaatatagaaaggcaaaatctcttaaagtgcctatcataacggaagaacaattt
agattgatgattgaatag

DBGET integrated database retrieval system