KEGG   Pradoshia sp. D12: F7984_02415
Entry
F7984_02415       CDS       T06218                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase 2 family protein
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
prd  Pradoshia sp. D12
Pathway
prd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    F7984_02415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_02415
Enzymes [BR:prd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     F7984_02415
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     F7984_02415
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-ProteinID: QFK73176
UniProt: A0A5J6XU12
LinkDB
Position
483773..484675
AA seq 300 aa
MWKETIHVEAPYDFDLVLERIGLDPLYEIDYRNRLIQVPLLINGKPNVYTVQAIGTVDKP
AFTISGKEEQVLATDRLMEIFQWHLPLSDIHAHFGETKLNDIFTRHRGTPLILEFDLYGC
LVKSIIHQQLNMAFAQKLTKDFVTAYGYQKDGVWFYPSPETTAALTVDELKGMKFSGRKA
EYVIGLSEKIASGELRLEELRTKTDEEIIEELTRIRGVGRWTAENFLLFGLGRPNLFPKA
DIGIQNAIKLLYNLERKPTMEEMEQFSKEWHPYLSYASLYLWRSIEKRRNIDEPTGNISP
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtggaaagaaaccattcatgtagaagctccctatgattttgacctggtattggaaagg
atcggtcttgatcctctgtatgaaatagattaccgcaatcgcttgattcaggtcccttta
ctgattaatggtaagcccaatgtttataccgtccaagcgatcggtacggtagataagccg
gcctttacgattagcggcaaagaagaacaagtattggcgacggatcgtttaatggagatt
tttcagtggcatctgccactttcagatatacatgctcactttggagagacgaagctcaat
gatatttttactcgccatcgcggtaccccgcttattttagaattcgacctatatggctgt
ctcgtgaaaagtattatccatcaacagctgaatatggcgtttgctcaaaaactaacgaag
gattttgtcacagcctatgggtatcagaaggacggagtatggttttatccatctccagag
acaaccgctgctctcacagtagatgagttaaaaggaatgaaattcagcggcagaaaagca
gagtatgtcattggcctttcagaaaagattgcaagcggtgaactcaggttggaagagttg
cgcacaaagacagatgaagaaattatagaagaattaacaagaattcgaggtgtaggcaga
tggacggctgaaaacttcctgttatttggtcttggccgcccgaatttatttccaaaagca
gacatcggcattcagaatgctattaagctgctatataacctagaacgaaagccaacaatg
gaagagatggagcaattcagtaaggagtggcatccttatttaagctacgcttcactttac
ttatggagaagcattgaaaaacggaggaatattgatgaaccaacaggcaacattagtccg
tga

DBGET integrated database retrieval system